SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017432 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017432
Domain Number 1 Region: 38-130
Classification Level Classification E-value
Superfamily FKBP-like 1.9e-28
Family FKBP immunophilin/proline isomerase 0.00000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017432   Gene: ENSOCUG00000021523   Transcript: ENSOCUT00000022719
Sequence length 131
Comment pep:novel chromosome:OryCun2.0:3:620986:621381:-1 gene:ENSOCUG00000021523 transcript:ENSOCUT00000022719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKGKSGSGKGGKGAAASGSDNADKKAQGPKGGGSAVKVRHILCEKHGKIMEAMEKLKS
GMKFSEVAAQYSEDKARQGGNLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKF
GYHIIMVEGRK
Download sequence
Identical sequences G1TKE6
ENSOCUP00000017432 9986.ENSOCUP00000017432 ENSOCUP00000017432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]