SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020044 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020044
Domain Number 1 Region: 327-459
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.63e-45
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 2 Region: 110-208
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000131
Family Scavenger receptor cysteine-rich (SRCR) domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020044   Gene: ENSOCUG00000027156   Transcript: ENSOCUT00000024488
Sequence length 461
Comment pep:known_by_projection chromosome:OryCun2.0:1:102681170:102692625:1 gene:ENSOCUG00000027156 transcript:ENSOCUT00000024488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSLMLEKPSPMEAQCTGQSPGPGTFGAKPGDQQQPISQAGCLCSVSRGWTVLGAVGLLVG
AGVGSWLLVLHLQPAASQPISEPLQEEGTTVNCSETSSQEALLPVFPKTVSFRINSEAFL
LEVQLRDRPDWILVCHEGWIPALGVRICRSLGHLRLTHHKGVNLSDIKFNGSWKFAQLSP
RLEGLLEEVWLPRDNCTSGRVVSLKCSGESGFGPMHLASCTLMLHQLFVHLWEEKRQVPF
RLSQRIHTPGADLLHLLWIYLFKFDFYSFNISKLTSYTITQREGEHCARRDQTPWWKSQN
GPEHFPAVGGTEGSRARVGTGTVCLSTDTVGAVCLPAEEQRFPGGSQCWVSGWGHTDPSH
AHNSDTLQDAVVPLLSSQLCNSSCMYSGALTPRMLCAGYLHGRADACQGDSGGPLVCPDG
HMWRLVGLVSWGRGCAEPNHPGVYANMAEFLDWIHDTVQSE
Download sequence
Identical sequences G1TSM6
ENSOCUP00000020044 9986.ENSOCUP00000020044 ENSOCUP00000020044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]