SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020351 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020351
Domain Number 1 Region: 88-439
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.83e-73
Family ADP-ribosylglycohydrolase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020351   Gene: ENSOCUG00000026982   Transcript: ENSOCUT00000029060
Sequence length 1332
Comment pep:known_by_projection scaffold:OryCun2.0:GL018956:150821:183343:1 gene:ENSOCUG00000026982 transcript:ENSOCUT00000029060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTRLLLRGTAQLAREPGSCFAPDAREPDTSHVVGYKLIGGTSTQERNVQPLRGRADGSS
DSINVSVAGRRQQRQGRRPQPQLPCPAPAMEKFKAAMLLGAAGDALGYSNCCRESSSAGS
VQSELQRSGGLDHLVLSPEQWPVSDNTIMHMATAEALTTDYWCLDDLYREMVRCYVEVIE
KLPERRPDPATIEGCSQLKPDNYLLAWHTPFNEKGSGFGAATKAMCIGLRYWKPERLDTL
IEVSVECGRMTHNHPTGFLGSLCTALFVSYAVQGKPLVQWGRDMVRVLPRAEDYCKRTIR
HMAEYQEHWFYFEAKWQFYLEERKISEDTENKAIFPDNYDAEERDKTYKKWSSEGRGGRR
GHDAPMIAYDALLAAGSSWDELCRRAMFHGGESGATGTIAGCLFGLLYGLDAVPRGLYQG
LEHQARLQDLGAALYRLSTEENPQSREPGGRAVPAHTQQGLRKRVSRTWDPAARALLGSL
LLYLASRADGPLAAEGPEHRAGRPPGPQEAQRRPTRFQLLQAKFMGSGREPHLKRTREVG
RLISRDKQGPGRSLVNATIHRLQESTGQAAGGPGQRPLPREKPRWGPPAGKSFVKNILKK
FLAVEEKEAGERPPAGRPKAPGRSSALCRLRERFEQSSCLCSEAGLLPLRKDSGKRKHLQ
RRKMHRPQVRVLHTATMASTCLRTPPARFLACTAEPLPALSIATVVCGPRSWLAHCARIS
HAESRRRPAQHPTLPLMAHGDGGLALSTERASHEGHALPGLVPVPSPGGARSAAGDRAVE
PRAGGSAGATWEVRAGPGEAPEVTMTVCSSDEEAEEAAPACEGDPVFATQKHLPEEKGLE
LIPPLQPLAVQAARRTQCAMESPQVTLRLPVIHEMPPAPQQSVASTPGGGHVADSTQAVF
PTMAEDRMGTRAAGRPAPEQGSQAQPAGTAGAGPEGPGAALGPKDAPRGGQDGRCGCQGP
GVLGGPECAPGVRAPELSYEKHRFPAPKENPTGSQGAASHSPRATKSHPGKSTWPSPSSQ
HGEAGGGSAAQDGRGPEGVTTADVWEQEEGKRPPETAPAQPPGAVQGDAGRSAQNRLPSL
DEATPGSRGSGQTAAMGNTEPPAVQSPGSTQSPETKTAGEWVTLDKKEGAARPAGRAVGE
GSRLPRGLAPEPGGRLPGLCAAEESSAPEGTGQRYPQGPAPAEPQLRLSNGWAASKSSRA
LGSRSEAVGEDSRGDGDQPQTAAARHPEPQGEHSAHGLGGPWGPLVAVQAQGGQQPPSAA
GPSHAHLTVPAKGAARQAEGAQAVLGEGAQAVQAEGAQAVLGEGAQAVQAEGAQAVQAEG
ARAVLGRGPRLC
Download sequence
Identical sequences G1TTI0
ENSOCUP00000020351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]