SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024229 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024229
Domain Number 1 Region: 220-462
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-86
Family Eukaryotic proteases 0.00000000434
Further Details:      
 
Domain Number 2 Region: 109-214
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000017
Family Hepsin, N-terminal domain 0.00000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024229   Gene: ENSOCUG00000005780   Transcript: ENSOCUT00000030064
Sequence length 474
Comment pep:known_by_projection scaffold:OryCun2.0:GL018786:19925:38073:1 gene:ENSOCUG00000005780 transcript:ENSOCUT00000030064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHPLPCMMGEAARPSRAPRRCRQPLPPGPPAPAGHHAPAQAWGRTLNQHHLAAPPPPTG
PWGGQTVPCCTGPRVAALTVGTLLLLTGIGAASWAIVTMLLRSNQEPLYPVQVSPVDGRL
AVLDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALAHSELDVRTAGANGTSGFFCVDEG
RLPHAWRLLDVLSVCDCPRGRFLTTVCQDCGRRKLPVDRIVGGQDTSLGRWPWQVSLRYD
GAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGY
LPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKMCTVTGWGNTQYYG
QQAGVLQEARVPIISSEVCNGPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSI
SRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAMRTHSEASGMVTQL
Download sequence
Identical sequences G1U4B0
ENSOCUP00000024229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]