SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025422 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025422
Domain Number 1 Region: 250-342
Classification Level Classification E-value
Superfamily TAFH domain-like 3.53e-33
Family TAFH domain-like 0.0000308
Further Details:      
 
Domain Number 2 Region: 648-696
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000001
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025422   Gene: ENSOCUG00000005480   Transcript: ENSOCUT00000022168
Sequence length 856
Comment pep:known_by_projection chromosome:OryCun2.0:9:67462832:67598517:1 gene:ENSOCUG00000005480 transcript:ENSOCUT00000022168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAAPPAAVSASGAVTMAPAGALPVRVESAPLGAVTKAPVSVCVEPSASQPL
RSPVGTLVTKVAPVSALPKLSGGPRLPAPQIVTVKAPNTTTIQLPANLQLPPGTVLIKSN
SGQLMLVSPQQAVTRAETTSNVTSRPAIPTNTQTVKICTVPNSSSQLIKKVAVAPVKKLA
QTGTTVVTTVPKPSSVQSVAAPTSVVTGTPVKPLNTVTTLKPSSLGASSTSSNEHNLKAE
SPAAAQTNLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVQKLVEQLLDAKIEAEE
FTKKLYVELKSSPQPHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSGEVVIATSTTTVT
ATPVVTTTVSLIQPEKPIIVSAAATPRTVSVQTLNPVTTGPVRAKTGVVTLHSVGPAAVP
GGTTAGTVLLQTSKPLVTSVPNTVTTVSLQPEKPVASGAAVTLALPSVTFRETSAAALCL
PSVKPVVTTAGTTSDKPVIAAPVQIKLAQSSPVLSQPAGIPQAVKVKQVVVQQPSGGVGK
QVTTLSHSSTLSIQKSGQKKMPVNTVIPTTSILKQITLPGNKILSLQASPIQKHKIKENG
TTCFRDEDDINDVTSMAGVNLHEENACILATNSELVGTLIQSCKDEPFLFIGALQKRILD
IGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIARHRMTTYKASENYILSSDTRSQL
KFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQHRDA
NLTALAAIGPRKKRPLESASEGLKDNLLASGTSSLTATKQLLRPRITRICLRDLIFCMEQ
EREMKYSRALYLALLK
Download sequence
Identical sequences G1U7L5
ENSOCUP00000025422 XP_002713657.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]