SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000027047 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000027047
Domain Number 1 Region: 115-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-26
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-25
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 4 Region: 170-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 468-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 8 Region: 76-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-16
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 217-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000318
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 10 Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000667
Family KRAB domain (Kruppel-associated box) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000027047   Gene: ENSOCUG00000029451   Transcript: ENSOCUT00000033998
Sequence length 525
Comment pep:novel chromosome:OryCun2.0:5:1899151:1913810:-1 gene:ENSOCUG00000029451 transcript:ENSOCUT00000033998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMENYANLLSLGYAISKPDVITLLEQGKEPWMIVKEETRWCADLESRCEIINHGKVHIYT
KCPSVTLNQKILNREKLYECDKCGKAFTHHTDLTIHHRIHVGGRLYECQQCGKLFNRASN
LLQHQRIHTGEKPYKCEACGMTFSRSIDLRVHQRIHTGEKPYECEECGKAFSRASYLTQH
RRVHTGEKSYVCHECGKAFSQRGGLKIHQRIHTGEKPYECKECGKAFSQASYLMQHDRIH
TGERPYECHECGMTFSRVIDLRVHHRIHTGEKPYKCKECGKAFSRASNLVQHERIHTGEK
PFECKECGMTFSHVYQLIPHQRTHTGVKPYECNECGKAFSHASVLIRHERIHTGEKPYKC
KECGKAFIHDGSLRMHQRIHTGEKPYECKECGKALSCISSLVKHQRIHTGEKPYECKVCF
RAFTHVESLRVHHRLHTGEKPYECKDCGKAFRSGHQLVIHHRLHTGEKPYQCKECGKAYS
VYGRLTRHQSIHSGQKPFECKNCGKSFSYNSSLKVHQRIHNRENL
Download sequence
Identical sequences U3KP87
ENSOCUP00000027047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]