SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012119 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012119
Domain Number 1 Region: 76-204
Classification Level Classification E-value
Superfamily Plus3-like 1.57e-45
Family Plus3 0.000000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012119   Gene: ENSORLG00000009661   Transcript: ENSORLT00000012120
Sequence length 420
Comment pep:known_by_projection chromosome:MEDAKA1:22:1136734:1194366:1 gene:ENSORLG00000009661 transcript:ENSORLT00000012120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELRAEPLKKKNKAAELLAKREPLKTSEVYSDDEEEEEEDDDKSSVKSDRSSRSSSYDD
DEKEETPPKSQPVSLPEELNRIRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNSSSKPVY
RVAEIVDVVETAKVYQLGSTRTNKGLQLRHGADTRVFRLEFVSNQEFTESEFMKWKEAMI
IAGMQVPTLDEITKKEQSIKEAVNYKFNDKDIEDIVKEKDRFRRAPPNYAMKKTQLLKDK
AMAEENGDGEKVKVIQDELNELEERAEALDRQRTKNISAISYINQRNRSWNIVESEKALV
AEGQNAKNQQMDPFTRRQCKPTMVSNARDPSVHAAILAHLNQKYGSGSGPDPSSTEKNTQ
DQASPKDKDVPKPTTDLSEDLFKVHDFDVKIDLQVPNAEETFLTQKDPEDYSRTEMLSDK
Download sequence
Identical sequences H2M138
ENSORLP00000012119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]