SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019436 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019436
Domain Number 1 Region: 13-264
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 9.89e-24
Family Tryptophan biosynthesis enzymes 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019436   Gene: ENSORLG00000015518   Transcript: ENSORLT00000019437
Sequence length 268
Comment pep:known_by_projection chromosome:MEDAKA1:3:36169638:36173008:1 gene:ENSORLG00000015518 transcript:ENSORLT00000019437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLELFGRLKSVVIGMIHVKALPGSPLGRLTMSQIVEEACREADVYREAGVDGLIVENM
HDVPYTFHVGPEVCACMTAVCVAVRRACPSLPLGVQILSSANRQALAVALASGLDFVRAE
GFVFSHVADEGLLNACAGDLLRYRRQIGAEHVQIFTDIKKKHSAHALTSDVTTEDTARAA
QFFLSDGLILTGAATGDPADPRQLRDVSRAVKIPVLIGSGVTLDNVDRYLDASGWIIGSH
FKVGGHWADAVDPDKVKRFMEKIRHLRK
Download sequence
Identical sequences H2ML63
ENSORLP00000019436 ENSORLP00000019436 XP_004067536.1.28442 XP_020556680.1.28442 XP_020556683.1.28442 XP_020556686.1.28442 8090.ENSORLP00000019436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]