SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000022366 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000022366
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.63e-50
Family D-ribulose-5-phosphate 3-epimerase 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000022366   Gene: ENSORLG00000017873   Transcript: ENSORLT00000022367
Sequence length 199
Comment pep:known_by_projection chromosome:MEDAKA1:21:26709614:26716482:-1 gene:ENSORLG00000017873 transcript:ENSORLT00000022367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSAKIGPSILSSDLSCLGSECVRMMECGADYLHLDVMDGHFVPNITFGHPMVECLRKC
VGQDPFFDMHMMVSRPEQWVKPMAAAGASQYTFHLEATTNPGNLIKEIRESRMKVGLAIK
PGTTVEELAPWANQIDMALVMTVEPGFGGQKFMDDMMPKAGANMIVSGSAVIGSDDPRSV
IALLRTAVAEAIQKRSLDR
Download sequence
Identical sequences H2MUA4
ENSORLP00000022366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]