SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025462 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025462
Domain Number 1 Region: 234-484
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.12e-59
Family Decarboxylase 0.000000423
Further Details:      
 
Domain Number 2 Region: 10-200
Classification Level Classification E-value
Superfamily PRTase-like 1.7e-40
Family Phosphoribosyltransferases (PRTases) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025462   Gene: ENSORLG00000020552   Transcript: ENSORLT00000025463
Sequence length 488
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig257:1256614:1259909:-1 gene:ENSORLG00000020552 transcript:ENSORLT00000025463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVMDDVSVDGLILKLHDVNAVKFGEYKLKSGLMTPIYIDLRVLVSHPRLMNQVSSLIYRC
VKEEGLQFQSVCGVPYTALPLATIICSTHELPMLIRRKEAKDYGTKKLVEGSFRGGDTCL
IIEDTVTSGSSILETADVLCKEGLKVTDAVVLMDREQGGVEMLASRGIRLLPVISMFKLL
DVLLAAGRIDGPTAQSVRRFIQDNNTFSFSSKKENGGEAATKKPCLDLKREQSYADRAQL
PNVHPLASKLLQIMEEKQSNLCVSADVTSSEELLQLADLLGPKICVLKTHVDILKDFTQD
FSLKLQVLADKHNFLIFEDRKFADIGNTVKHQYEGGVYQISSWSHIVNAHAVPGPGVVRG
LCAVGKPLGRGCLLLAQMSSSGSLATGGYTAAAVQMAEEHSDFVMGFICCSKVTQSPQFI
HMTPGVQLEAGGDSLGQQYATPEEVICRRGSDIIIVGRGILEAPDRLKAAESYRQSGWDA
YMKTRSGQ
Download sequence
Identical sequences H2N1Z7
8090.ENSORLP00000025462 ENSORLP00000025462 ENSORLP00000025462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]