SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000324 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000324
Domain Number 1 Region: 249-337
Classification Level Classification E-value
Superfamily TAFH domain-like 2.22e-34
Family TAFH domain-like 0.0000366
Further Details:      
 
Domain Number 2 Region: 643-691
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000377
Family TBP-associated factors, TAFs 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000324   Gene: ENSORLG00000000264   Transcript: ENSORLT00000000324
Sequence length 853
Comment pep:known_by_projection chromosome:MEDAKA1:6:350326:368292:1 gene:ENSORLG00000000264 transcript:ENSORLT00000000324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKGAPGPAASSSASQVVNHSIPLMQPKVPPPAAAVQPEVSQPPGVKPAVNGLVQPAAATP
ARTPLPGGPTSIQQQKPALMAGVTRPVAPQLAVRPQQQQATIQLPSGFTIPPGMVLVRTE
TGQLVLVPQQVLAQAQVCGNFTSRGAILEFPEWIELCSYFNNSHSSGITRKCFVILIKKK
MAQSPSTTTVQGLTVAPGSSVVSVKMPTAQKTQTGMVAGGVTPVEPPVTAGAPPASAPTA
SRVTVLSQQEMQENVKKCKNFLATLIKLASHNSPSPETAKNVKALVQDLLDAKIEPEEFT
SRLQADLKSSPQPYLIPFLKKSLPALRQTLFSSQQFLTTAPPVTPAPAPAAPGSIAATAI
RPRLPTAATGGAVRLNPPMTNTTALPPIIQVFPLKNYNPISWTFSASIFTVFPKGPPPAA
ARPGAQVLQTRSPVVIGHQECVLADQNQQPLAAVFAVTLLRGPLCTAGKSPVSLAASANQ
KKQCDPGGGTFSLYFVGTRLETQIDTRFAPSTGAKGTLRRALFSRRCCILPVCFFNQPCY
SHNAAATQAEGELFVFTPPCTAPPCSFLNTYNSMATRALAPPLAPKTHVGLQPSTTAAFR
DDDDINDVASMAGVNLNEENARILATSSEIVGTKIRSCKDEFFLPADVLHRRILDTARKL
GVTEVPADVVNVVSHATQFRLRSLLEKVSVVAQHRADAVKDEDLYEQTSDVRAQLRFFEQ
LERIEKQRKDEQEREMLLKAAKSRARQEDPEQARLKQKAKEMQQQELAQMRQRDANLTAL
AAIGPRKKRKLDSVGGANTGSEVSSGLGSLGSPSPRQQLRQRITRVNLRDFILCLEQDRS
TARSMALYKALLK
Download sequence
Identical sequences H2L3K0
ENSORLP00000000324 8090.ENSORLP00000000324 ENSORLP00000000324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]