SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002421 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002421
Domain Number 1 Region: 5-557
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.19e-77
Family Acetyl-CoA synthetase-like 0.0000406
Further Details:      
 
Domain Number 2 Region: 720-1062
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.2e-46
Family Quinoprotein alcohol dehydrogenase-like 0.0038
Further Details:      
 
Domain Number 3 Region: 570-623
Classification Level Classification E-value
Superfamily ACP-like 0.000000916
Family Peptidyl carrier domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002421   Gene: ENSORLG00000001947   Transcript: ENSORLT00000002422
Sequence length 1065
Comment pep:known_by_projection chromosome:MEDAKA1:4:4426804:4434763:-1 gene:ENSORLG00000001947 transcript:ENSORLT00000002422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARTLQAAVSAAASLHADRTAVVFDSGGLAPGPPASLLYRELADLSAELSCVFLSRCSP
VNGVIGLYCSDDLLVPVWILGILQCPAAYMPLDPEAPALLTAQAMSQSGLTFCAVNTHLM
QVAFFTYLTFEVCETLPKFELTLIQIRKLSFAKPEPGTQQDSHQESGCAAPLSEGGAAHR
ELAYVLHTSGTTGPPKTVRVPHTCIVPNILHLRSLLQMSASDVVFLASPLTFDPSVVDIF
LALSSGAQLLIVPSLIKKTPRRLAGLLFKDHKVTVLQVTPSLLLRFGHRTLKEEALSPGS
SLRVLALGGEACPPPALLRSWKHQENKTCIFNLYGITEVSCWACCYKIPETLLQSSDPGE
VPLGAPLMDTEVEVRDELGRVVTEGEGQLFLGGGDRVCLLDGESTVVPGTMRATGDWVKI
RDQQLHYQGRKDRTIKRNGKRVNLDRLQQLLLGLPEVAACALGLHSSSRLLAFVVSAGAA
ERRCSSSAELDLLSSVRQQSEEVRGAGGDGKRRILEQLSVLLPSHGIPDTLELLPALPVT
PHGKVDMVALMTLYERQREHLGFPRGEAHKLKQRLQALWKDALGLPGDADLDEQSNFLQS
GGDSLKAVRLCEDIGDGVGASTPQLLEVLLDGTFSELWRHVALLLEGCPPTSLPAKKRHA
DPPSDAAAKRERKPAERRAVRVVQRAGRVTGMNVRTDTRETLGDGGRRGTQSHRAVKVEL
SLSWASDSGRCVDASPMLLVTDGVSERPDGCRTTVFIGSHSHRVQALDLGSGTLLWERVL
GDRVEASAATSSCGTLVIVGCYDGCIYFLSADSGETRWTFRTGDAVKSCPAVDGVGGLVF
AGSHDGNVYALDPQAQRCVWKRHCGGGGVFSSPHLHDSPRQLYVATLAGRLLSLNPDSGD
ELWSYHRGVPFFSSPNSSCSGVVIGSVDENICCVAHTGELLWQCPTQGPVFSSPCFIREQ
RKLLCGSHDGRLYCLSAADGSVVWTFQTPGRVYSSPCVFDGCGGGALVALASTDGTVWIL
EAENGQMLASHALPGELFSSPVVWAGCLVIGCRNDYVYALNLTYK
Download sequence
Identical sequences H2L982
ENSORLP00000002421 8090.ENSORLP00000002421 ENSORLP00000002421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]