SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008173 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008173
Domain Number 1 Region: 625-1015
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.67e-91
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000923
Further Details:      
 
Domain Number 2 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.39e-68
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000267
Further Details:      
 
Domain Number 3 Region: 290-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 7.72e-68
Family Lipovitellin-phosvitin complex, superhelical domain 0.00000195
Further Details:      
 
Domain Number 4 Region: 1043-1210
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.71e-44
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008173   Gene: ENSORLG00000006511   Transcript: ENSORLT00000008174
Sequence length 1221
Comment pep:known_by_projection chromosome:MEDAKA1:4:10630699:10642146:1 gene:ENSORLG00000006511 transcript:ENSORLT00000008174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLLCCFVALATCQSLRYDVSLNPKKSYEYRYEGMVNFGLGKQNLAESGVKITCKVKI
TGASEQTYVLQVSDLAFAEYNGFPGKNGYDASPELTSRIAAQLVKPFMFEYANGHVGDIR
ASPEVSTTIVNIVRGILDFFQVTVKTTQRVYDLEEVGIHGKCQSYYTIEENMEAKNVTIS
QVVDVTKCREKAEKYKGMATAVVDKLSKQRGESVYSTVRNVYTIKPTTEGGLLTKAEGRE
RQHFTPFNVKGGAFKMQATKELVLLGVSDTASTPTFGPMESKGDIIFKFANINYNFPILM
QNLEDPIPKITKLIKRLAAANSYQVDSASTEDCMKLYQLMKVVPFEGLTVLWKEFEGNPE
QRRWFLDVTVEIGDARTFNFLKSRFQARDLTPTEAWQTYLMAVEHLEATLELVEISKEFL
RIPYSKSDINLWHTVVLSYGSVVYKHCAYHTPCPVSTVQPLLDMATEALRDNDKEDMILV
LKALGNAGHPGSIKTIMRFLPGVAATPKDLPPAVQSAAVQAMRLIAARDPHSVQDITMSL
ILQKDLPSEIRMLALVILFDAKPSMAAVSTVTEHLLDEEDLHVASFAYSYLEGFARSTTP
DNHFLSTAANVAVKILAPKFGRLSYYYSKAKHMDWFDDDFLIGTATEMYMIRNAAYMFPS
EVMMSGKLHVIGRIVKLLDLGMRLEGLKELFGAGIPGFKGDYSFSDFEAILRVLDSWEDL
PNNEPLFTAYSRASGQEWFYADVSKDLLRSIITALNPSAWKGSPLWAAIESLKSGASWHY
SRAFLIIEASYFLPSTLGLPVEISKYYNSITVMTVNAKAVAKPPPTQHLHQLLNSEIELE
TDGFAGVTKDFWVFYGVNTELFQSGSEFHNKVPIGLPWKFTTKVNIPEKKFELEFPPCTK
EIPLISMRADVYAISRNIAEPDMHKRTPIMPNPTESNAESQKPFWNPNYWHPSYNMCAES
DIYGVGMCMEYDLRRQYYHEEFPLYYFLGYSHMELKIVPVNTTKTVEKIYFEVNAGTFKH
PINAQLLQSLAQLSKGRSSTPEALFNFKALAMAGNQKHEGYDAAVYYTPEANAHSTQLIV
SQVGANTNWKMCVDTSVDARPEAKTHLRWGAECQSYEMSMTAGALHMNSSKPTLMSKVQF
VRIPEYMEEMGKRVERYIPGMGLLLGFYQENERNANQEVSASITAVSEDSIDVNIQFPEY
TVYRKAVPLSVGFQHNMTTPQ
Download sequence
Identical sequences H2LQ37
ENSORLP00000008173 8090.ENSORLP00000008173 XP_004067788.1.28442 XP_020557968.1.28442 ENSORLP00000008173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]