SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014095 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014095
Domain Number 1 Region: 415-804
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.95e-127
Family Ankyrin repeat 0.0000000000261
Further Details:      
 
Domain Number 2 Region: 159-392
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.31e-68
Family Ankyrin repeat 0.00000491
Further Details:      
 
Domain Number 3 Region: 5-239
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.15e-62
Family Ankyrin repeat 0.0000125
Further Details:      
 
Domain Number 4 Region: 1419-1502
Classification Level Classification E-value
Superfamily DEATH domain 8.07e-22
Family DEATH domain, DD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014095   Gene: ENSORLG00000011244   Transcript: ENSORLT00000014096
Sequence length 1616
Comment pep:known_by_projection chromosome:MEDAKA1:12:17641030:17681627:1 gene:ENSORLG00000011244 transcript:ENSORLT00000014096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADAATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGI
ELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKF
LLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTA
AVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRR
GNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPI
HMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARAL
NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTEVMMEKRKIFFFFARPPTLXXXXIVKNF
LQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHK
ELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVA
SKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGY
TPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNL
GNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQ
QAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSKGACPPGHAKRLGYISVI
DVLKLVTEESVSTITTEKHRMSFPETVDEILDVSEDEENFHISPTGDELLGLDGARYFKL
DDFKDQDDDFLSPKKTLRDFEGGVGTTPYSPAIPRIPCVSPETVQLDQHTPIPLPKEYDE
DSLIPSSPATETSDNVSPVASPIHTGFLVSFMVDARGGSMRGSRHHGLRVIIPPRTCAAP
TRITCRLVKPQKLTTPPPLVEGEGLASRIISLGPSSMQFLGPVIVEIPHFASLGRGDREL
VVLRSENGSVWKEHRNRYGDEVLETILNGMDEDLESQEELEKKRIRRIISTDFPLYFAVV
SRIQQESDLIGPEGGRLTSKLVPHVEAIFPESAVTKRVRLGLQAQPIPDELLTRQLGNQA
TFSPVVTIEPRRRKFHRPIGLRIPLPPSWRESPRDAGEGDTTSLRLLCSVIGGTAPAQWE
DITGTTKLMYAHNCASFTTNVSARFWLADCPRTAEAVTFANLLYKELMAIPYMAKFVIFA
KMNEAREGRLRCYCMTDDKMDKTLELHENFSEVARSRDIELMEGMPLHLECSGNLVPIRK
ATQQPRSFSFQAFRDNRLPVSVKVRDSNKEATGFLSFLRKCTKYEDAQHVLCNLNITMPP
CVKVAGSEERRRTLTPLALRERYSALNDPAAVTVNAMERTEIKINIISEQLGLSWAELAR
ELQFGVDDINRIRVENPNSLLDQSSTLLNLWASREGKKAKMESLYTALRNIDRADIVASL
EGQPPPAGPESLEEGACRLSDRDSTLLSPSVINGYGLVQEELLSPASLQYSLQSPLGVEP
YWQEVSSLECAPIATTEEDTLMEMSDVQVWPAGVSPSLVTVEDSSLEGSSRADDSE
Download sequence
Identical sequences H2M6K0
ENSORLP00000014095 ENSORLP00000014095 8090.ENSORLP00000014095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]