SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014852 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014852
Domain Number 1 Region: 279-359
Classification Level Classification E-value
Superfamily TAFH domain-like 9.55e-27
Family TAFH domain-like 0.000033
Further Details:      
 
Domain Number 2 Region: 655-702
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000167
Family TBP-associated factors, TAFs 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014852   Gene: ENSORLG00000011854   Transcript: ENSORLT00000014853
Sequence length 860
Comment pep:known_by_projection chromosome:MEDAKA1:7:18419925:18436509:1 gene:ENSORLG00000011854 transcript:ENSORLT00000014853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQRGVSSSAGCLVPRMDGAAGVTPAAEAVGNPAQSQPQPATASSPVTKSDCTKSVILTGG
QAAPPPGATATIRSPGVWPNPRTAAPSTIAAAPGGVRPPAPQVLAPRLSQPQQNTTNIQN
IQLPPGMVLIRSESGQLLMIHQQTLAQMQAQSQSQSAMTPRPAAPTSTPPVQTSLQTPGT
PLLTRPVTSTTIIKQASPVQTTGIVTTALQRPPVLQRSVAKNTVMLGVTASGQPMGTAAK
VQPAAQRVGPLGATGTAVAPTPVSAVREKSEPFSQQNQAPNETLENVKKCRNFLSTLIKL
ASGKQSPQTSANVKELIKNLLQAKIEPEDFTSRLYKELSSSPQPYLVPFLKLDYLSLYTA
FQTEQTFFLYCIKQETMSDPTVHTITALLQTVPVTRQQYGSNSTNRAGIIQISVSSTVFA
VQRSLPALRQMTPDPDAFIQQSLLPLPSTQPVATASTALTAVVLRPPLSTTVTTATSTTK
ATVISLTQTPQSKPGLXFHECEQIVSQQQGTMVRPQVPLAQSPVVTIRGQPHSRIIVGQP
QVVKQLTAVKHSLISNFDKMVILTLLPSCEPPVPAVRQTLAPGIRGVQVLGHASVADAHR
NRLKEAGGGAFKDDDDINDVASMAGVNLSEESARILATSSELVGMVTRSCKDEAFLSTPS
LTRIALEIGKKFGVSELGTDVISYISHATQQRLQNLLEKVSQVAHHKNVTLKEDERCEQV
SDVRGQLKFFEQLDQLEKQRKEEQEREILLKAAKSRSRQEDPEQLRLKQKAKEMQQLELA
QIRQREANLAALAAIGPRKKRKTDSPVKGAGADPGGSGGAGSRQFTRQRITRVNLRDLLF
CLENEKETSHSQLLYKGFLK
Download sequence
Identical sequences H2M8N2
8090.ENSORLP00000014852 ENSORLP00000014852 ENSORLP00000014852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]