SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016972 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016972
Domain Number 1 Region: 184-275
Classification Level Classification E-value
Superfamily TAFH domain-like 2.35e-34
Family TAFH domain-like 0.00000554
Further Details:      
 
Domain Number 2 Region: 551-599
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000138
Family TBP-associated factors, TAFs 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016972   Gene: ENSORLG00000013539   Transcript: ENSORLT00000016973
Sequence length 756
Comment pep:known_by_projection chromosome:MEDAKA1:5:26093440:26102479:1 gene:ENSORLG00000013539 transcript:ENSORLT00000016973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPQPVLSAPQPPSMAAGGLRAPNPQMLAPRLPQTSTGQPSVHNIQLPPGMVLVRSESGQ
LLMIPQQALAQMQAQVQGGMAPRPSTPTNMPLGQIILMWKSNSWLNFRKLKIMDLPLILP
LGNTIISRQVSPSAISRQSCPAPTPLTASTTLHRPPILQVRGYKQKQRNKKIYNMKKKHL
DLGTETLENVKKCKNFLATLIKLASSGKQSSETAASVRELIKELLEGKVEAEEFTSRLYK
ELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQHPQAASGPVSSSSSSTVVQGSPAP
RLAAPAIKPQLQPATNKPGHPTPLTAVWKRWHLIKDSKFILMSSARSCKKESCVLQKIQS
QALSLTKELITLIFINIEMMNIPAARSGAQGAAGGHFEMKQHRLHVKICLVIPRKTKRSP
ETCPVAAENGAEASASHGVHPNDGGEESGSCSHHCGTASVQVVLQREFPFCLAVPLRPDG
ALVSKQVFAAALTPAQRNKLKEAGGTFKDDDDINDVASMAGVNLSEESANILATNSGLVG
AVTHSCKDEAFLSCAVLQRRMLEISKRHGVTDLGTDVVTFISHATQQRLQNLLEKVSFVA
QQKNINLKESENYEQSSDVRAQLKFFEQLDQLEKQRKEEQEREILLKAAKSRARQEDPEQ
LRLKQKAKEMQQQELAQMRQREANLTALAAIGPRKKRKNLDSPSSSASAEMGGAGSSSSR
PTRQRITRVNLRDLLFCLEDERFTSRSHFLYKGFLK
Download sequence
Identical sequences H2MEG6
8090.ENSORLP00000016972 ENSORLP00000016972 ENSORLP00000016972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]