SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017289 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017289
Domain Number 1 Region: 255-386,422-491
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.4e-29
Family Hemopexin-like domain 0.00066
Further Details:      
 
Domain Number 2 Region: 25-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000327
Family Somatomedin B domain 0.0018
Further Details:      
 
Domain Number 3 Region: 67-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000103
Family Somatomedin B domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017289   Gene: ENSORLG00000013785   Transcript: ENSORLT00000017290
Sequence length 492
Comment pep:known_by_projection chromosome:MEDAKA1:17:21657483:21664667:-1 gene:ENSORLG00000013785 transcript:ENSORLT00000017290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKMMMKLGFLLLILAVISDAAATGSCVGRCGEAFTRGQPCTCDFGCMQHNECCPDFEAS
CTAASAPSCRGHCDEPFRRGRPCDCDRQCVLFNTCCHDYQLHCENSSTIQIKQTLRQTKR
LKINKKKQMILANYNQETEGAGKQLNDLIVQGRCPQCRGAQRQSSFGLFKPRTVGSSGPA
SPSSPAGHLQTGLLPSPSSPRGTSPHVPAPGPSQPSLGASALGSSPPKSPSGPGGAGNGL
KVQMLLYPDMPSGTDLCSDPFIDGLTALNNGTILIFKGELFWSVEPVSHSVGSPQRITET
LGIPSPIDTAFTRTDCNRNTYIIKEDQYWQFDGNMVMKPGFPKPLKSEFPGLTGSISAAL
AVPATSSRAETVFFFKKGDIMLRFTFPPCSTPSLEPRSSLKKNIAGQTGHFRADALLSAE
INIRVSLKAFPTPVTAAVSMHTPQGSDRYQHFIFSGPLFFKVHITGDLPAVAKPDPAVTL
TLNSIRFWLHCP
Download sequence
Identical sequences H2MFB7
8090.ENSORLP00000017289 ENSORLP00000017289 ENSORLP00000017289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]