SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023196 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023196
Domain Number 1 Region: 335-574
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-52
Family YWTD domain 0.00000212
Further Details:      
 
Domain Number 2 Region: 25-284
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-51
Family YWTD domain 0.00000242
Further Details:      
 
Domain Number 3 Region: 636-898
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-51
Family YWTD domain 0.00000464
Further Details:      
 
Domain Number 4 Region: 945-1201
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-34
Family YWTD domain 0.0000936
Further Details:      
 
Domain Number 5 Region: 1332-1369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 1254-1293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 7 Region: 901-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000298
Family EGF-type module 0.036
Further Details:      
 
Domain Number 8 Region: 1294-1330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 592-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000309
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 289-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000372
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1210-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000226
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023196   Gene: ENSORLG00000018545   Transcript: ENSORLT00000023197
Sequence length 1528
Comment pep:known_by_projection ultracontig:MEDAKA1:ultracontig72:579291:622356:1 gene:ENSORLG00000018545 transcript:ENSORLT00000023197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAKARAALQRCGVAIFCTFLSWSPLLLFANRRDVRLVDGEGPRGESAIVVSDLEDAAAV
DFFFAEGLIFWTDVSEEAIKQTRWNQSSNYQIVVVPGLDSPDGLACDWLSKKLYWTDSET
NRIEVANLNGTSRKVLFWMDLDQPRAIALNPAQRYMYWTDWGEEPRIERAGMDGSRREVI
VNEDIFWPNGLTVDLEEQKLYWADAKLSFIHRANLDGSAREAVVEGTLTHPFALTLSNET
LFWTDWQTHSIHACNKHRGDKTREILGGIYSPMGIQVLESYRQPYIRTPCSDNNGGCSHL
CLLSPVPPFYSCTCPTGVQLRADGKTCKPGAEQVLLLARRTDLRRISLDLPDFTDIVLQV
DGIRHAIAIDYDPVEGYVYWTDDEVRAIRRSRLDGSNAVMLVTTEINHPDGIAVDWVSRN
LYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLDPVNGYMFWSDWGERPKIERANL
DGTDRLVLLNTSLGWPNGLALDYATGKLYWGDAKTDKIEVINVDGTGRKTLLEDKLPHIF
GFTLLGDYIYWTDWQRRSIERVHKVTAVREIIIDQLPDLMGLKATKVTETHGTNGCAVEN
GGCSHLCFWRRRAVSCACPMGMELLPDLQTCVVPEAFLLFTNRDSIRSISLGTNSNDVAI
PLTGIKEASALDFDVSEKRIYWTDIQAKTISRAYMNGSSVEHVIEFGLDYPEGMAVDWMG
HNIYWADTGTNRIEVARLDGQYRQVLVCKDLDNPRSLDNPRSLALDPANGFMYWTEWGGL
PRIARAYMDGSIITTLVEKVGRANGLTIDYVDHRLYWTDLDTYMIESSNMLGLQREIVVD
DLPHPFGLTQYKDFIYWTDFNLRTIERADKRGGLNRTVILKGQLELMMDILVFHSSRQDG
TNECSLNNGDCAHLCLATPTGAQCRCTSHYTLNPDGRNCSSPSSFLLFTQKNSISRMVLG
EQSPDIILPIHVVKARAVHYDPVDRLIYWLDGRQNIRRARDDGAMLFTPLMATSTAQPVE
NQLHDLSLDPYSRHVYWTCENTNTINVQRMDGHTVGVVVKDNTDKPRAIVVNAERGYMYF
TTVQERSAKIEGASLDGTERESLFTTGLIRPVALALDNKLGKLFWIDADLKRIESSDLTG
ANRVVLQDSNILQPMGLTVLGEHLYWIDRQQQMIERVDKLTGDRRTRVQGRISFLTSIHA
VEEMDPREFELHPCSRNNGGCSHICIAKGDGTPRCSCPIHLVLASDLLRCGEPPTCSPEQ
FTCSTGDIDCIPLAWRCDGFPECEDGSDEDNCPVCSVSHFQCDEGSCIDAHKRCDGEPDC
ADKSDEHDCEVICSPGEFRCGDNQCITKKQRCDGYSDCPDGLDELACGTDHAPPPSSFNH
DPKPIIPVIAIMLLVFVIGGVYFACQRVEWRCYKGPNGTFPRDYIGGTPHVPLNFIAPSS
SQHGTFQGISCGKSIMSSVSLMGSSSSGAPLYDRNHVTGASSSSSSSTKGAYYPQILNPP
PSPATDRSLYNTEIYSSNSPSTTRSYRY
Download sequence
Identical sequences H2MWF7
ENSORLP00000023196 ENSORLP00000023196 8090.ENSORLP00000023196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]