SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bmb021059 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb021059
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 4.02e-33
Family Insect phospholipase A2 0.0000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb021059
Sequence length 137
Sequence
MGDGTKWCGKGDIAKSYEDLGSARETDMCCREHDHCTDLILAGETKHGLTNDAFYTRLNC
KCDEAFRLCLNKANTKTSRRIGKIYFNALGTKCYRQDYPVVGCNTYGGLFRKKCLEYDYD
TRSEQIYQWFDVRNYAN
Download sequence
Identical sequences Bmb021059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]