SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bmb023395 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb023395
Domain Number 1 Region: 52-183
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.27e-33
Family Insect phospholipase A2 0.0000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb023395
Sequence length 188
Sequence
MIACWSCFIVLIALYVNRVTGSWFANDSAVNIDKDVLDIQSERIARKKFDFIFPGTKWCG
KGDIAKNYEDLGSARETDMCCREHDHCTDLILAGETKHGLTNDAFYTRLNCKCDEAFRLC
LNKANTKTSRRIGKIYFNALGTKCYRRDYPVVGCNTYGGLFRKKCLEYDYDTRSEQIYQW
FDVRNYAN
Download sequence
Identical sequences Bmb023395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]