SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bmb025690 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb025690
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily Plus3-like 5.36e-22
Family Plus3 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb025690
Sequence length 151
Sequence
MFQVAEIIDVHETGKVYNLGNTRTNKGFKLRHGTQDRAFRLEFVSNQEFTDGEFHKWYKA
LKDANKKPPTMDFVRNKINEVKQALMYEFKEEDIEKIVAEKERFRSHPTNYAMKKTQLMK
ERDVAQLRYEQHALVCRDVLNKDGALGHTRI
Download sequence
Identical sequences Bmb025690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]