SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb008506 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb008506
Domain Number 1 Region: 5-229
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.63e-92
Family GABA-aminotransferase-like 0.0000000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb008506
Sequence length 231
Sequence
MSAKLLNSNLWEADPELFDIIVKEKDRQRAGLEMIASENFTSVPVLQCLSSCLHNKYSEG
MPNQRYYGGNEYIDEIEILAQNRSLEAYRLKSEEWGVNVQPYSGSPANFAVYTGIVEPHG
RIMGLDLPDGGHLTHGFFTATKKISATSIFFESMPYKVDPKSGLIDYDKLAETAKLFKPR
LIIAGMSCYSRCLDYKRFREIADANGAYLMADMAHVSGLVAAGDYQHLYSY
Download sequence
Identical sequences Bmb008506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]