SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bmb009790 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb009790
Domain Number 1 Region: 62-145
Classification Level Classification E-value
Superfamily TAFH domain-like 2.09e-26
Family TAFH domain-like 0.00044
Further Details:      
 
Domain Number 2 Region: 335-380
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000711
Family TBP-associated factors, TAFs 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb009790
Sequence length 542
Sequence
MAGSIGAASWRRDGVNKHGLQPYTGSDASCADGNACYTSIYTKYKLRYASASISTPNGNN
CSNLLDLSSKEPPSVEMNVRNLIQELIDAQVEPEEFCNRLERLLNASPQPCLIGFLKKSL
PLLRQSLVTKELVIEGINPPAPHIAFSTMPSPAQPVVATSNIQLPSEEDGSSPTLTPLLP
PVMPLTLANLTKPINVQSLQTTAPTQQQKPPSKPGSTIAVLQNIPVHTKINVSKVSSGKS
MQLNNKGAFPRGQLPSAALSTVLTPGKSLLKDKEKKSSSYSQPFTDDKMAGDDDINDVAA
MGGVNLAEESQRILGSTEMIGTQIRSCKDEYLVPTSVMQARVKAIIARHNLDEPTGEVAA
LISHAVQERLKNLIEKLAVIAQHRIDHFIKSDSRYEVTQDVKGQLKFLEELDRVDKKRRE
DSEREMLLRAAKSRSKNEDPEQAKLKAKAKEMQRAELEELRQREANLTALQAIGPRKKPR
LEAPGASGDTATPGPQTTGFPGRSQLALRTRLKRINHRDMLFLLEQERDTCRSLLLYKSY
LK
Download sequence
Identical sequences Bmb009790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]