SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bmb013404 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb013404
Domain Number 1 Region: 33-729
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.18e-244
Family Motor proteins 0.000000000348
Further Details:      
 
Domain Number 2 Region: 1461-1577
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-21
Family Second domain of FERM 0.0029
Further Details:      
 
Domain Number 3 Region: 1578-1666
Classification Level Classification E-value
Superfamily PH domain-like 7.03e-19
Family Third domain of FERM 0.019
Further Details:      
 
Domain Number 4 Region: 1400-1469
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000413
Family First domain of FERM 0.074
Further Details:      
 
Domain Number 5 Region: 1127-1185
Classification Level Classification E-value
Superfamily SH3-domain 0.00000294
Family SH3-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb013404
Sequence length 1678
Sequence
MAQDLVWIKPQGRSEFDIPVAVKILNSSGDRIQVQDDDGKVFSTTVHDVIKPLHATSICG
VEDMITLGELQEYTILRNLHLRYNEQLIYTYTGSMLIAINPYEILPIYTMDQIHFYQNSQ
IGDIPPHIFAIGDNSYRKLIETSSNQCIVISGESGAGKTESTKLLLQYLAAASGKHSWIE
QQIQETNPILEAFGNAKTVKNDNSSRFGKYVNIYFNRKGILEGGNIDQYLLEKSRIVFQN
KGERNYHIFYSLVSGLSADEKKSLLAAILHLGNLKFKSFNVNNIESSEVVDAVNANRIAT
LLGVNKTDLCEALTRKTFVAHGEKVVSTLTVASAIESRDALVKAIYGHIFEYIVDTINKT
LHKDQQLTSGSVGILDIFGFENFDSNSFEQLCINYANENLQQFFVKHIFKLEQEQYEKEG
ITWTNINYVDNQENLNMIGMRPMNLLALIDEESRFPKGTDITLLSKLNSNHSNKNCYIAA
KSSREHRFGVRHFAGAVFYEVAGFLDKNRDLLTTDVKEIMFDSNNQFLKGLFASEFTETR
NSSRKTISLSNQFKASLDTLMKNLYACHPFFVRCIKPNELKKPRVFDKALCVRQLRYAGL
METAKIRQAGYPIRYTYVSFVHRYRFLIPGIPPAERTDCKSATKKICTEVLKDQEFRLGH
TKVFLKDTHDYLLEELRHTIFTTAVIRVQANARRFICRRRFLKMRAAAITIQKHYRARGL
RHRFLVMRRGYSRIQAVIKSRELRRTFLHLRSFFRNLQAHCRGYLIRKLVKEKGTLIKAK
LLQLKSEKEKLEKSGKDEQFIADDHEKKFTELLRSIWIVKEIAVDDNEQNISAIDDRYVD
DVFGFLKDSSTPGGTVRGAGFGVTSTAKPEMSSIIPMPQEYEEEQFDEFNFRKFAATYFS
GNTSHQYSRKPLRHSLLELPSPMDKVASQALWITILRFMGDLAEPKYVDDKIDNIPVMTK
LTDTIGRAFQKSKEFEEMLIKDGNQNKSRLVSKTLKRQSKLNEVFIKNLLNDETTNEIFF
EALKLKGDAISKDIIIVAVNWTGIYIVDQLEHILLEIAYSEVTYVAYDDDTDLENIGKVT
IRTIQQEEFVFQSVDAGEMSSLIIYIIDGLKRRSAYVVAQSDSQGYADASSFLQFKKGDL
ITLLHDSTGETLMNATWGHGACNGQEGLFPTEQVYILPTLEKPSNSVLEVFKKGTVNNDK
KPYQYNTVQRKRMHTLEKYAKEYFRENYDVNTTVSRQSTLTTAKKPIAGDLWVHSREPIR
KPLLKKIQDDEKLSKNAIAAYYAILKYMGDMPAPKPKSATEYTDEIFKNAISEPALRDEI
YCHIMKQLTNNRIQLSEERGWELLWLATGVFACSQVLMKELVEFLKTRPHPIAKDCLKRL
FKTQKYGSRMYAPYVVEVEAIQHRSMQIYHKVYFPDDTDEAFEVDSSTKARDLCEQITGR
LNLKNSDGSTQMQMNYQIFFMKKLWINTVPGRDKNADQIFYFPQELPKYLRGYHKTSKQD
LVELAALVYRARFGSDQSLLAQISHLLEDFVPSDMIRIQSNSQWKSSIVTAYLQHGNMTE
SEAKEQFLKKIYQLPTFGTAFFEVKQTSDPAYPEMVIVGINKNGVSLVHPQSRDVLITHP
FSQLSNWSSGNTFFHMTMGNFLRGTKILCETSLGYKMDDLISSYIAVLRASLNQNSRG
Download sequence
Identical sequences Bmb013404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]