SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bmb024499 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb024499
Domain Number 1 Region: 50-165
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000000000000589
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb024499
Sequence length 232
Sequence
KEIGYKIKATLGVTPVWKSDDSEFLLKFDLRNPKLHLRGKHPTAEFLPRPSPLDSYSEAP
FYALWNKGTVETLYLDPKEMKDVYNLKKALASLFQFHIIDGEYKETDISGECDVIYESIS
ENVFRKMKRRCSWESAQVGCARVARYTLRPARDGLLAVYSEELLTVGDHYGLKFRSFVSL
KAKEDSEAAKPSTEELDVALHGLPANLKPMGLPMVLSADDEKEYQVRFCYPA
Download sequence
Identical sequences Bmb024499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]