SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bmb028073 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb028073
Domain Number 1 Region: 167-567
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.02e-63
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.01
Further Details:      
 
Weak hits

Sequence:  Bmb028073
Domain Number - Region: 69-135
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 0.000589
Family Lipovitellin-phosvitin complex, superhelical domain 0.026
Further Details:      
 
Domain Number - Region: 6-60
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0051
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb028073
Sequence length 1126
Sequence
MQVLQSTLNVESKVINGVPEKVAATEEYLYKPFSIGENGARAKVHTKLTLTGKGKAVAPS
SKCTDVNSIIFENPHSGEKVPKNDHACLGAVKEVAKSVTNNVGANSASSFAQLVRILRRT
EKEDLVKVFNQVKGNTLEKSSANPDKRLAREHYGLIRTPKKFNSDDRKYSFYREMSYNID
ALGAGGSVDETVIYSQDSYLPRSVNFNLTVSLFGHDFNVLEFGGRQGNLDRVLEHFLGPK
SFLRTESPQAIYDSLVKRFEEAKKKVEDGLTRGRRSVKTEIDSFDKNLKAEAAPYNNELD
LDIFVKLFGTDAVFLSFGDDKGFDFNKILDDILGTCSSGISKLKHFQTDFRTHLLFLDAE
LAYPTSTGLPLHLNLVGSATAKLDLATNIDVRQIIYSPQNAKIDVKFIPSTDLEIAGAFL
VDAYAVTTGLKVSTTLRSSTGVHVIAKILENGRGFDLQLALPVDKQELLVASNDLLYVTA
ERGQNEKYVPIKIGTAPKEYPACFDQLSSVLGLTLCTEFTTPFAISKDTRGPSDDSIAQF
LARFPLSGSAKVKVVLEKNDLRGYHIKGVVREDKGAGKRSFELLFDAEGSRNRRTQLTGE
VVYNDHEVGLQIALDSPIKVLHAQISAYNKPNEMVALVKAKIDNLEYYAKAGFAVQGNAQ
RSIYKPILEYQLAEDGGKKHEIKVDGQMVKESNGQITRYSLEGVQINLPNTEEPLQITGH
AANQPQTREFDFDVAVKNFASLKGGVKGTNINLEFENKLNPVINFKLKGIFEFTDTIHNE
IDLQYGPNFKDPNSRIFLSQLLKYHIKSAEDFNIITQNKFEIRAIPFKIVAEADIDPKKV
IVEIGGQVEQRSAAFELEARTQIEKPGDYSVKIKGNVDKFCVEVLAKRNILNADKSNLEN
YVDIKGYGRYELSGVLLHKNKPNDVNLGAIGHLKISSSGKSDDIKFDVGVVENTHFYSSH
AVISNSKGTLLDYLLKISRGGTPSGQLKFVLKDTIAANGEYKVTGNDGKGNGVVIVDFKT
LQRKFKADVSFLAKEPVFNANIDLYLDFDKNKNDKICFSTNTKKTDKLLESKNKLEYGGK
NFELNIHLEGNFDLTGATRAKVEIVLPNERCLSYEVNRNIAVNNAG
Download sequence
Identical sequences Bmb028073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]