SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145294032|ref|YP_001139957.1| from Shigella sonnei Ss046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145294032|ref|YP_001139957.1|
Domain Number 1 Region: 246-521
Classification Level Classification E-value
Superfamily Colicin 2.09e-93
Family Colicin 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145294032|ref|YP_001139957.1|
Sequence length 521
Comment colicin E1 protein [Shigella sonnei Ss046]
Sequence
METAVAYYKDGVPYDDKGQVIITLLNGNPDGSGSGGGGGTGGSKSESSAAIHATAKWSTA
QLKKTQAEQAARAKAAAEAQAKAKANRDALTQHLKDIVNEALRHNSTHPEVIDLAHANNA
AMQAEAERLRLAKAEEKARKEAEAAEKAFQEAEQRRKEIEKEQAETERQLKLAEDEEKRL
AALSEEARAVEVAQKNLAAAQSELAKVDEEINTLNTRLSSSIHARDAETNTLSGKRNELD
QASAKYKELDERVKLLSPRANDPLQSRPFFEATRLRARAGDEMEEKQKQVTASETRLNQI
SSEINGIQEAISQANNKRSTAVSRIHDAEDNLKTVQTNLLNSQIKDAVDATVSFYQTLSE
KYGEKYSKMAQELADKSKGKKISNVNEALAAFEKYKDVLNKKFSKADRDAIFNALEAVKY
EDWAKHLDQFAKYLKITGHVSFGYDVVSDILKIKDTGDWKPLFLTLEKKAVDAGVSYVVV
LLFSVLAGTTLGIWGIAIVTGILCAFIDKNKLNTINEVLGI
Download sequence
Identical sequences A4SH37
gi|145294032|ref|YP_001139957.1| 300269.SSON_PB01 WP_000447004.1.100389 WP_000447004.1.101889 WP_000447004.1.101937 WP_000447004.1.10576 WP_000447004.1.10862 WP_000447004.1.10995 WP_000447004.1.11440 WP_000447004.1.11595 WP_000447004.1.12000 WP_000447004.1.13346 WP_000447004.1.14094 WP_000447004.1.14154 WP_000447004.1.14451 WP_000447004.1.16669 WP_000447004.1.16894 WP_000447004.1.18311 WP_000447004.1.19487 WP_000447004.1.19845 WP_000447004.1.20370 WP_000447004.1.20831 WP_000447004.1.21171 WP_000447004.1.22809 WP_000447004.1.23062 WP_000447004.1.23257 WP_000447004.1.24982 WP_000447004.1.25346 WP_000447004.1.25602 WP_000447004.1.27683 WP_000447004.1.28414 WP_000447004.1.28835 WP_000447004.1.30221 WP_000447004.1.31801 WP_000447004.1.32333 WP_000447004.1.32435 WP_000447004.1.33171 WP_000447004.1.3415 WP_000447004.1.34983 WP_000447004.1.36159 WP_000447004.1.36281 WP_000447004.1.36299 WP_000447004.1.36537 WP_000447004.1.36971 WP_000447004.1.3749 WP_000447004.1.37940 WP_000447004.1.38264 WP_000447004.1.38419 WP_000447004.1.42095 WP_000447004.1.42277 WP_000447004.1.42359 WP_000447004.1.42369 WP_000447004.1.42791 WP_000447004.1.42828 WP_000447004.1.42966 WP_000447004.1.46245 WP_000447004.1.46734 WP_000447004.1.47451 WP_000447004.1.48417 WP_000447004.1.49259 WP_000447004.1.50273 WP_000447004.1.50381 WP_000447004.1.5041 WP_000447004.1.50993 WP_000447004.1.51320 WP_000447004.1.52011 WP_000447004.1.52111 WP_000447004.1.52240 WP_000447004.1.52413 WP_000447004.1.53277 WP_000447004.1.53308 WP_000447004.1.5351 WP_000447004.1.54946 WP_000447004.1.5566 WP_000447004.1.56388 WP_000447004.1.56777 WP_000447004.1.58368 WP_000447004.1.59689 WP_000447004.1.597 WP_000447004.1.59855 WP_000447004.1.60559 WP_000447004.1.60816 WP_000447004.1.61223 WP_000447004.1.61718 WP_000447004.1.62348 WP_000447004.1.62992 WP_000447004.1.63602 WP_000447004.1.64280 WP_000447004.1.65192 WP_000447004.1.6553 WP_000447004.1.66102 WP_000447004.1.66335 WP_000447004.1.66432 WP_000447004.1.66791 WP_000447004.1.67938 WP_000447004.1.68752 WP_000447004.1.69441 WP_000447004.1.70747 WP_000447004.1.71922 WP_000447004.1.72262 WP_000447004.1.72392 WP_000447004.1.72414 WP_000447004.1.73498 WP_000447004.1.73631 WP_000447004.1.74879 WP_000447004.1.75143 WP_000447004.1.76118 WP_000447004.1.7637 WP_000447004.1.76612 WP_000447004.1.77288 WP_000447004.1.78746 WP_000447004.1.79088 WP_000447004.1.80011 WP_000447004.1.80388 WP_000447004.1.80731 WP_000447004.1.80882 WP_000447004.1.8091 WP_000447004.1.81281 WP_000447004.1.82032 WP_000447004.1.82438 WP_000447004.1.85793 WP_000447004.1.85800 WP_000447004.1.88352 WP_000447004.1.8854 WP_000447004.1.89097 WP_000447004.1.89510 WP_000447004.1.89841 WP_000447004.1.9118 WP_000447004.1.92932 WP_000447004.1.939 WP_000447004.1.94753 WP_000447004.1.94801 WP_000447004.1.95403 WP_000447004.1.96753 WP_000447004.1.9708 WP_000447004.1.97802 WP_000447004.1.98886 WP_000447004.1.99774 gi|145294032|ref|YP_001139957.1|NC_009346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]