SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|74311524|ref|YP_309943.1| from Shigella sonnei Ss046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74311524|ref|YP_309943.1|
Domain Number 1 Region: 21-112
Classification Level Classification E-value
Superfamily YccV-like 1.19e-29
Family YccV-like 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|74311524|ref|YP_309943.1|
Sequence length 122
Comment heat shock protein HspQ [Shigella sonnei Ss046]
Sequence
MWNFTLISKVKISREVTMIASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVN
DELRAAPWYHVVMEDDNGLPVHTYLAEAQLSSELQDEHPEQPSMDELAQTIRKQLQAPRL
RN
Download sequence
Identical sequences A0A0A0FAT4 A0A0F6MBJ9 A0A192CKQ5 A0A1X3IA87 A0A1X3J442 A0A1X3JK13 A0A1X3KJA1 A0A1X3KR79 A0A1X3L4W7 C3TFK2 D2ABM4 D3QPG2 D7X256 D7XJ32 D7YAH3 D7ZG43 D8A7T9 D8EBV8 E1J292 E3PIZ0 E6BCY4 E9TEK5 F4NDX8 F4SMG3 F4SX47 F4TCJ6 F4V0I8 F4VCZ2 J7QKD4 U9XFM8 U9XY37 U9YF83 U9ZUL4 V0AIJ4 V0SUX6 V0VA72 V0XVH6 V0YV42 V8KTN1 W8ZQF4
gi|91210063|ref|YP_540049.1| gi|386633420|ref|YP_006153139.1| gi|82544710|ref|YP_408657.1| gi|110804982|ref|YP_688502.1| APC27449 ER261 gi|26246989|ref|NP_753029.1| 155864.Z1318 198214.SF0968 198215.S1034 199310.c1104 300268.SBO_2265 300269.SSON_0971 362663.ECP_0972 364106.UTI89_C1033 373384.SFV_0976 405955.APECO1_71 gi|74311524|ref|YP_309943.1| gi|386638306|ref|YP_006105104.1| gi|15800825|ref|NP_286841.1| gi|30062505|ref|NP_836676.1| gi|117623176|ref|YP_852089.1| gi|24112379|ref|NP_706889.1| gi|291281966|ref|YP_003498784.1| gi|386704146|ref|YP_006167993.1| gi|384542546|ref|YP_005726608.1| gi|386628500|ref|YP_006148220.1| gi|387611509|ref|YP_006114625.1| gi|110641156|ref|YP_668886.1| NP_706889.1.23235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]