SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|74313525|ref|YP_311944.1| from Shigella sonnei Ss046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|74313525|ref|YP_311944.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.05e-110
Family FMN-linked oxidoreductases 0.00000000000972
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|74313525|ref|YP_311944.1|
Sequence length 672
Comment NADPH dehydrogenase [Shigella sonnei Ss046]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A0I4U6D0 A0A2I6JYW3 Q3YXQ3
300269.SSON_3124 WP_000121451.1.100063 WP_000121451.1.100135 WP_000121451.1.100315 WP_000121451.1.100389 WP_000121451.1.100448 WP_000121451.1.10048 WP_000121451.1.100725 WP_000121451.1.100758 WP_000121451.1.100852 WP_000121451.1.101121 WP_000121451.1.101175 WP_000121451.1.101214 WP_000121451.1.101486 WP_000121451.1.101594 WP_000121451.1.101887 WP_000121451.1.101889 WP_000121451.1.101937 WP_000121451.1.101940 WP_000121451.1.101942 WP_000121451.1.102093 WP_000121451.1.10329 WP_000121451.1.10348 WP_000121451.1.10352 WP_000121451.1.10508 WP_000121451.1.10525 WP_000121451.1.10576 WP_000121451.1.10628 WP_000121451.1.10771 WP_000121451.1.10862 WP_000121451.1.10995 WP_000121451.1.11251 WP_000121451.1.11323 WP_000121451.1.11440 WP_000121451.1.11452 WP_000121451.1.11499 WP_000121451.1.11595 WP_000121451.1.11762 WP_000121451.1.12000 WP_000121451.1.12095 WP_000121451.1.12112 WP_000121451.1.1218 WP_000121451.1.12204 WP_000121451.1.12292 WP_000121451.1.1280 WP_000121451.1.13346 WP_000121451.1.13383 WP_000121451.1.13411 WP_000121451.1.13492 WP_000121451.1.13566 WP_000121451.1.13589 WP_000121451.1.13740 WP_000121451.1.13981 WP_000121451.1.14094 WP_000121451.1.14127 WP_000121451.1.14154 WP_000121451.1.142 WP_000121451.1.14299 WP_000121451.1.14451 WP_000121451.1.14499 WP_000121451.1.14648 WP_000121451.1.14711 WP_000121451.1.1486 WP_000121451.1.14861 WP_000121451.1.14965 WP_000121451.1.15007 WP_000121451.1.15148 WP_000121451.1.15191 WP_000121451.1.15565 WP_000121451.1.15771 WP_000121451.1.1580 WP_000121451.1.15894 WP_000121451.1.16015 WP_000121451.1.16188 WP_000121451.1.16303 WP_000121451.1.16604 WP_000121451.1.16640 WP_000121451.1.16669 WP_000121451.1.16894 WP_000121451.1.16970 WP_000121451.1.17042 WP_000121451.1.17089 WP_000121451.1.17186 WP_000121451.1.17205 WP_000121451.1.17230 WP_000121451.1.1726 WP_000121451.1.17300 WP_000121451.1.17301 WP_000121451.1.17441 WP_000121451.1.17570 WP_000121451.1.17765 WP_000121451.1.1778 WP_000121451.1.17836 WP_000121451.1.18311 WP_000121451.1.18354 WP_000121451.1.18511 WP_000121451.1.18583 WP_000121451.1.18628 WP_000121451.1.18806 WP_000121451.1.19113 WP_000121451.1.19122 WP_000121451.1.19315 WP_000121451.1.19338 WP_000121451.1.19487 WP_000121451.1.19758 WP_000121451.1.19838 WP_000121451.1.19845 WP_000121451.1.19873 WP_000121451.1.19945 WP_000121451.1.20025 WP_000121451.1.20096 WP_000121451.1.20192 WP_000121451.1.2022 WP_000121451.1.20230 WP_000121451.1.20290 WP_000121451.1.20370 WP_000121451.1.20636 WP_000121451.1.20668 WP_000121451.1.20813 WP_000121451.1.20831 WP_000121451.1.2093 WP_000121451.1.21022 WP_000121451.1.21059 WP_000121451.1.21129 WP_000121451.1.21131 WP_000121451.1.21171 WP_000121451.1.21197 WP_000121451.1.21305 WP_000121451.1.21656 WP_000121451.1.21673 WP_000121451.1.21727 WP_000121451.1.21762 WP_000121451.1.21811 WP_000121451.1.22268 WP_000121451.1.22295 WP_000121451.1.2232 WP_000121451.1.22470 WP_000121451.1.22501 WP_000121451.1.22641 WP_000121451.1.22809 WP_000121451.1.22827 WP_000121451.1.22846 WP_000121451.1.22961 WP_000121451.1.22990 WP_000121451.1.23057 WP_000121451.1.23062 WP_000121451.1.23081 WP_000121451.1.23120 WP_000121451.1.23257 WP_000121451.1.23270 WP_000121451.1.23293 WP_000121451.1.23352 WP_000121451.1.23388 WP_000121451.1.23443 WP_000121451.1.23456 WP_000121451.1.23486 WP_000121451.1.2353 WP_000121451.1.23554 WP_000121451.1.23561 WP_000121451.1.23563 WP_000121451.1.23584 WP_000121451.1.23660 WP_000121451.1.23729 WP_000121451.1.23795 WP_000121451.1.23881 WP_000121451.1.23886 WP_000121451.1.23931 WP_000121451.1.23971 WP_000121451.1.24 WP_000121451.1.24051 WP_000121451.1.24058 WP_000121451.1.24120 WP_000121451.1.24194 WP_000121451.1.24290 WP_000121451.1.2437 WP_000121451.1.24533 WP_000121451.1.2456 WP_000121451.1.24560 WP_000121451.1.24570 WP_000121451.1.24783 WP_000121451.1.24791 WP_000121451.1.24981 WP_000121451.1.24982 WP_000121451.1.25060 WP_000121451.1.25289 WP_000121451.1.25346 WP_000121451.1.254 WP_000121451.1.25403 WP_000121451.1.25517 WP_000121451.1.25598 WP_000121451.1.25602 WP_000121451.1.25717 WP_000121451.1.25718 WP_000121451.1.25753 WP_000121451.1.25855 WP_000121451.1.2588 WP_000121451.1.2589 WP_000121451.1.25915 WP_000121451.1.26135 WP_000121451.1.26570 WP_000121451.1.26766 WP_000121451.1.27105 WP_000121451.1.27683 WP_000121451.1.27786 WP_000121451.1.28168 WP_000121451.1.28414 WP_000121451.1.28433 WP_000121451.1.28440 WP_000121451.1.28769 WP_000121451.1.28791 WP_000121451.1.28835 WP_000121451.1.29055 WP_000121451.1.29079 WP_000121451.1.29146 WP_000121451.1.29197 WP_000121451.1.29556 WP_000121451.1.29643 WP_000121451.1.29699 WP_000121451.1.29740 WP_000121451.1.2986 WP_000121451.1.29933 WP_000121451.1.30016 WP_000121451.1.30141 WP_000121451.1.30221 WP_000121451.1.30347 WP_000121451.1.30401 WP_000121451.1.30700 WP_000121451.1.30960 WP_000121451.1.31026 WP_000121451.1.31353 WP_000121451.1.31434 WP_000121451.1.31482 WP_000121451.1.31527 WP_000121451.1.31625 WP_000121451.1.31696 WP_000121451.1.31736 WP_000121451.1.31801 WP_000121451.1.31899 WP_000121451.1.31903 WP_000121451.1.32049 WP_000121451.1.32078 WP_000121451.1.32236 WP_000121451.1.32242 WP_000121451.1.32333 WP_000121451.1.32435 WP_000121451.1.327 WP_000121451.1.32715 WP_000121451.1.32741 WP_000121451.1.33171 WP_000121451.1.33237 WP_000121451.1.33362 WP_000121451.1.33413 WP_000121451.1.33561 WP_000121451.1.33729 WP_000121451.1.34003 WP_000121451.1.3415 WP_000121451.1.34380 WP_000121451.1.34541 WP_000121451.1.34557 WP_000121451.1.34655 WP_000121451.1.34668 WP_000121451.1.34983 WP_000121451.1.3521 WP_000121451.1.35654 WP_000121451.1.35983 WP_000121451.1.36159 WP_000121451.1.36281 WP_000121451.1.36299 WP_000121451.1.36537 WP_000121451.1.36971 WP_000121451.1.37076 WP_000121451.1.37101 WP_000121451.1.3730 WP_000121451.1.37419 WP_000121451.1.3749 WP_000121451.1.37543 WP_000121451.1.37940 WP_000121451.1.38264 WP_000121451.1.38419 WP_000121451.1.38610 WP_000121451.1.38827 WP_000121451.1.39015 WP_000121451.1.3903 WP_000121451.1.39111 WP_000121451.1.39157 WP_000121451.1.39373 WP_000121451.1.39468 WP_000121451.1.39580 WP_000121451.1.39730 WP_000121451.1.40121 WP_000121451.1.40159 WP_000121451.1.40183 WP_000121451.1.40623 WP_000121451.1.40668 WP_000121451.1.4081 WP_000121451.1.41230 WP_000121451.1.41244 WP_000121451.1.41259 WP_000121451.1.41457 WP_000121451.1.41479 WP_000121451.1.41606 WP_000121451.1.41718 WP_000121451.1.41778 WP_000121451.1.42095 WP_000121451.1.42096 WP_000121451.1.42277 WP_000121451.1.42284 WP_000121451.1.42300 WP_000121451.1.42359 WP_000121451.1.42369 WP_000121451.1.42750 WP_000121451.1.42761 WP_000121451.1.42791 WP_000121451.1.42828 WP_000121451.1.42830 WP_000121451.1.42966 WP_000121451.1.43324 WP_000121451.1.43374 WP_000121451.1.43566 WP_000121451.1.4400 WP_000121451.1.44314 WP_000121451.1.44424 WP_000121451.1.44426 WP_000121451.1.44539 WP_000121451.1.44686 WP_000121451.1.448 WP_000121451.1.44814 WP_000121451.1.44818 WP_000121451.1.44848 WP_000121451.1.45068 WP_000121451.1.45156 WP_000121451.1.45494 WP_000121451.1.45500 WP_000121451.1.45962 WP_000121451.1.45991 WP_000121451.1.4617 WP_000121451.1.46245 WP_000121451.1.4643 WP_000121451.1.46468 WP_000121451.1.46541 WP_000121451.1.46643 WP_000121451.1.46655 WP_000121451.1.46734 WP_000121451.1.46857 WP_000121451.1.47135 WP_000121451.1.47316 WP_000121451.1.47350 WP_000121451.1.47416 WP_000121451.1.47451 WP_000121451.1.47582 WP_000121451.1.4773 WP_000121451.1.47914 WP_000121451.1.47981 WP_000121451.1.47983 WP_000121451.1.48087 WP_000121451.1.48285 WP_000121451.1.48404 WP_000121451.1.48417 WP_000121451.1.48590 WP_000121451.1.48602 WP_000121451.1.48825 WP_000121451.1.48907 WP_000121451.1.49259 WP_000121451.1.49431 WP_000121451.1.49528 WP_000121451.1.49777 WP_000121451.1.49902 WP_000121451.1.50136 WP_000121451.1.50273 WP_000121451.1.50329 WP_000121451.1.50381 WP_000121451.1.5041 WP_000121451.1.50446 WP_000121451.1.50539 WP_000121451.1.506 WP_000121451.1.5061 WP_000121451.1.50993 WP_000121451.1.51127 WP_000121451.1.51320 WP_000121451.1.51354 WP_000121451.1.51364 WP_000121451.1.51482 WP_000121451.1.51503 WP_000121451.1.51513 WP_000121451.1.51542 WP_000121451.1.51624 WP_000121451.1.51662 WP_000121451.1.51869 WP_000121451.1.51906 WP_000121451.1.52011 WP_000121451.1.52044 WP_000121451.1.52111 WP_000121451.1.52225 WP_000121451.1.52236 WP_000121451.1.52240 WP_000121451.1.52304 WP_000121451.1.52324 WP_000121451.1.52328 WP_000121451.1.52413 WP_000121451.1.52554 WP_000121451.1.52567 WP_000121451.1.52755 WP_000121451.1.52942 WP_000121451.1.52996 WP_000121451.1.53099 WP_000121451.1.53186 WP_000121451.1.53277 WP_000121451.1.53308 WP_000121451.1.53419 WP_000121451.1.53431 WP_000121451.1.5351 WP_000121451.1.53535 WP_000121451.1.53574 WP_000121451.1.53841 WP_000121451.1.5395 WP_000121451.1.53968 WP_000121451.1.5440 WP_000121451.1.54614 WP_000121451.1.54641 WP_000121451.1.54921 WP_000121451.1.54946 WP_000121451.1.55291 WP_000121451.1.55482 WP_000121451.1.55483 WP_000121451.1.55581 WP_000121451.1.5566 WP_000121451.1.55727 WP_000121451.1.55979 WP_000121451.1.56101 WP_000121451.1.56345 WP_000121451.1.56388 WP_000121451.1.5649 WP_000121451.1.56713 WP_000121451.1.56776 WP_000121451.1.56777 WP_000121451.1.56787 WP_000121451.1.56908 WP_000121451.1.56951 WP_000121451.1.56992 WP_000121451.1.57269 WP_000121451.1.57319 WP_000121451.1.57574 WP_000121451.1.57588 WP_000121451.1.57628 WP_000121451.1.57634 WP_000121451.1.57903 WP_000121451.1.57951 WP_000121451.1.57975 WP_000121451.1.5812 WP_000121451.1.58368 WP_000121451.1.58484 WP_000121451.1.58496 WP_000121451.1.58680 WP_000121451.1.59218 WP_000121451.1.59302 WP_000121451.1.59396 WP_000121451.1.59689 WP_000121451.1.597 WP_000121451.1.59855 WP_000121451.1.5990 WP_000121451.1.59914 WP_000121451.1.60005 WP_000121451.1.60186 WP_000121451.1.60246 WP_000121451.1.60443 WP_000121451.1.60559 WP_000121451.1.60570 WP_000121451.1.60599 WP_000121451.1.60614 WP_000121451.1.60644 WP_000121451.1.60671 WP_000121451.1.60684 WP_000121451.1.60771 WP_000121451.1.60816 WP_000121451.1.60826 WP_000121451.1.60847 WP_000121451.1.60921 WP_000121451.1.61148 WP_000121451.1.61223 WP_000121451.1.61268 WP_000121451.1.61362 WP_000121451.1.61373 WP_000121451.1.61496 WP_000121451.1.61612 WP_000121451.1.61643 WP_000121451.1.61703 WP_000121451.1.61718 WP_000121451.1.61893 WP_000121451.1.61966 WP_000121451.1.62303 WP_000121451.1.62348 WP_000121451.1.6245 WP_000121451.1.62507 WP_000121451.1.62513 WP_000121451.1.62802 WP_000121451.1.62992 WP_000121451.1.63023 WP_000121451.1.63602 WP_000121451.1.63679 WP_000121451.1.63800 WP_000121451.1.63871 WP_000121451.1.63990 WP_000121451.1.64280 WP_000121451.1.64437 WP_000121451.1.64540 WP_000121451.1.64634 WP_000121451.1.6469 WP_000121451.1.64821 WP_000121451.1.64866 WP_000121451.1.64895 WP_000121451.1.65135 WP_000121451.1.6516 WP_000121451.1.65192 WP_000121451.1.65296 WP_000121451.1.6553 WP_000121451.1.65667 WP_000121451.1.65677 WP_000121451.1.65714 WP_000121451.1.66102 WP_000121451.1.6622 WP_000121451.1.66264 WP_000121451.1.66335 WP_000121451.1.66432 WP_000121451.1.66791 WP_000121451.1.66975 WP_000121451.1.67193 WP_000121451.1.67462 WP_000121451.1.67467 WP_000121451.1.67704 WP_000121451.1.67901 WP_000121451.1.67938 WP_000121451.1.67984 WP_000121451.1.68053 WP_000121451.1.68108 WP_000121451.1.68126 WP_000121451.1.68145 WP_000121451.1.68281 WP_000121451.1.68369 WP_000121451.1.68482 WP_000121451.1.68584 WP_000121451.1.68598 WP_000121451.1.68630 WP_000121451.1.68635 WP_000121451.1.68679 WP_000121451.1.68752 WP_000121451.1.68880 WP_000121451.1.69039 WP_000121451.1.6919 WP_000121451.1.69192 WP_000121451.1.6929 WP_000121451.1.69441 WP_000121451.1.69537 WP_000121451.1.69730 WP_000121451.1.69979 WP_000121451.1.70081 WP_000121451.1.70256 WP_000121451.1.70509 WP_000121451.1.70530 WP_000121451.1.70600 WP_000121451.1.70656 WP_000121451.1.70728 WP_000121451.1.70747 WP_000121451.1.71037 WP_000121451.1.71170 WP_000121451.1.71223 WP_000121451.1.71264 WP_000121451.1.71273 WP_000121451.1.7147 WP_000121451.1.71560 WP_000121451.1.71832 WP_000121451.1.71922 WP_000121451.1.71945 WP_000121451.1.72054 WP_000121451.1.72120 WP_000121451.1.72126 WP_000121451.1.72155 WP_000121451.1.72262 WP_000121451.1.72293 WP_000121451.1.72391 WP_000121451.1.72392 WP_000121451.1.72414 WP_000121451.1.72574 WP_000121451.1.72593 WP_000121451.1.72615 WP_000121451.1.72651 WP_000121451.1.72738 WP_000121451.1.72804 WP_000121451.1.72998 WP_000121451.1.73015 WP_000121451.1.73193 WP_000121451.1.73278 WP_000121451.1.73498 WP_000121451.1.73592 WP_000121451.1.73631 WP_000121451.1.73652 WP_000121451.1.73811 WP_000121451.1.73980 WP_000121451.1.74053 WP_000121451.1.74213 WP_000121451.1.74223 WP_000121451.1.74294 WP_000121451.1.74465 WP_000121451.1.7471 WP_000121451.1.74716 WP_000121451.1.74793 WP_000121451.1.74867 WP_000121451.1.74873 WP_000121451.1.74879 WP_000121451.1.74889 WP_000121451.1.74914 WP_000121451.1.74975 WP_000121451.1.75138 WP_000121451.1.75143 WP_000121451.1.75219 WP_000121451.1.75221 WP_000121451.1.75247 WP_000121451.1.75568 WP_000121451.1.75602 WP_000121451.1.75698 WP_000121451.1.75803 WP_000121451.1.76089 WP_000121451.1.76118 WP_000121451.1.7637 WP_000121451.1.76466 WP_000121451.1.76544 WP_000121451.1.76612 WP_000121451.1.76705 WP_000121451.1.76884 WP_000121451.1.77120 WP_000121451.1.77288 WP_000121451.1.77391 WP_000121451.1.77448 WP_000121451.1.77600 WP_000121451.1.77725 WP_000121451.1.77741 WP_000121451.1.7795 WP_000121451.1.78059 WP_000121451.1.7806 WP_000121451.1.78340 WP_000121451.1.78390 WP_000121451.1.7851 WP_000121451.1.78553 WP_000121451.1.78696 WP_000121451.1.78746 WP_000121451.1.79002 WP_000121451.1.79088 WP_000121451.1.79090 WP_000121451.1.79226 WP_000121451.1.79308 WP_000121451.1.79416 WP_000121451.1.80011 WP_000121451.1.80192 WP_000121451.1.80292 WP_000121451.1.80388 WP_000121451.1.80456 WP_000121451.1.80545 WP_000121451.1.80594 WP_000121451.1.80676 WP_000121451.1.80731 WP_000121451.1.80736 WP_000121451.1.8074 WP_000121451.1.808 WP_000121451.1.80843 WP_000121451.1.80882 WP_000121451.1.8091 WP_000121451.1.80954 WP_000121451.1.81071 WP_000121451.1.81180 WP_000121451.1.81281 WP_000121451.1.81298 WP_000121451.1.8156 WP_000121451.1.81602 WP_000121451.1.81692 WP_000121451.1.81881 WP_000121451.1.81952 WP_000121451.1.82032 WP_000121451.1.82061 WP_000121451.1.82095 WP_000121451.1.82116 WP_000121451.1.82280 WP_000121451.1.82320 WP_000121451.1.82330 WP_000121451.1.82438 WP_000121451.1.82614 WP_000121451.1.82705 WP_000121451.1.83033 WP_000121451.1.83160 WP_000121451.1.83177 WP_000121451.1.83330 WP_000121451.1.83466 WP_000121451.1.84074 WP_000121451.1.84462 WP_000121451.1.84768 WP_000121451.1.85141 WP_000121451.1.85156 WP_000121451.1.85305 WP_000121451.1.85369 WP_000121451.1.85385 WP_000121451.1.85685 WP_000121451.1.85767 WP_000121451.1.85793 WP_000121451.1.85800 WP_000121451.1.85895 WP_000121451.1.86 WP_000121451.1.86063 WP_000121451.1.86518 WP_000121451.1.86846 WP_000121451.1.87059 WP_000121451.1.87608 WP_000121451.1.8771 WP_000121451.1.87786 WP_000121451.1.87984 WP_000121451.1.88066 WP_000121451.1.88189 WP_000121451.1.88352 WP_000121451.1.88413 WP_000121451.1.88438 WP_000121451.1.8854 WP_000121451.1.88577 WP_000121451.1.88685 WP_000121451.1.88864 WP_000121451.1.89018 WP_000121451.1.89097 WP_000121451.1.89111 WP_000121451.1.89403 WP_000121451.1.89510 WP_000121451.1.89605 WP_000121451.1.89841 WP_000121451.1.89925 WP_000121451.1.90249 WP_000121451.1.90436 WP_000121451.1.90758 WP_000121451.1.9084 WP_000121451.1.91138 WP_000121451.1.9118 WP_000121451.1.91526 WP_000121451.1.91630 WP_000121451.1.91701 WP_000121451.1.91793 WP_000121451.1.92029 WP_000121451.1.92031 WP_000121451.1.92195 WP_000121451.1.924 WP_000121451.1.92462 WP_000121451.1.92495 WP_000121451.1.92506 WP_000121451.1.92535 WP_000121451.1.92571 WP_000121451.1.92793 WP_000121451.1.92796 WP_000121451.1.92932 WP_000121451.1.92991 WP_000121451.1.93133 WP_000121451.1.93468 WP_000121451.1.93742 WP_000121451.1.938 WP_000121451.1.939 WP_000121451.1.93900 WP_000121451.1.93921 WP_000121451.1.94429 WP_000121451.1.94497 WP_000121451.1.94516 WP_000121451.1.94523 WP_000121451.1.94690 WP_000121451.1.94753 WP_000121451.1.94801 WP_000121451.1.94877 WP_000121451.1.94963 WP_000121451.1.95036 WP_000121451.1.95233 WP_000121451.1.95403 WP_000121451.1.95431 WP_000121451.1.95596 WP_000121451.1.95756 WP_000121451.1.95759 WP_000121451.1.95821 WP_000121451.1.95835 WP_000121451.1.96032 WP_000121451.1.96293 WP_000121451.1.96420 WP_000121451.1.96683 WP_000121451.1.96701 WP_000121451.1.96753 WP_000121451.1.96779 WP_000121451.1.96850 WP_000121451.1.9708 WP_000121451.1.97195 WP_000121451.1.97527 WP_000121451.1.97675 WP_000121451.1.97711 WP_000121451.1.97775 WP_000121451.1.97802 WP_000121451.1.97895 WP_000121451.1.98208 WP_000121451.1.98284 WP_000121451.1.98498 WP_000121451.1.98587 WP_000121451.1.98641 WP_000121451.1.98886 WP_000121451.1.98908 WP_000121451.1.99053 WP_000121451.1.9907 WP_000121451.1.99110 WP_000121451.1.99427 WP_000121451.1.99641 WP_000121451.1.99774 WP_000121451.1.99791 WP_000121451.1.99912 gi|74313525|ref|YP_311944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]