SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000024 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000024
Domain Number 1 Region: 4-419
Classification Level Classification E-value
Superfamily Cytochrome P450 1.17e-80
Family Cytochrome P450 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000024   Gene: ENSMODG00000000019   Transcript: ENSMODT00000000025
Sequence length 429
Comment pep:novel chromosome:BROADO5:3:429103977:429119545:-1 gene:ENSMODG00000000019 transcript:ENSMODT00000000025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REKVGTLSTVNVHLPQDAEKVLRAEGPLPQRMATMPWIVHRRTRNHKCGIFLLNGKEWLN
DRIKMNQDVLSPSGADHFIPLLNTICQDFVQYLDVRIRRNVRQSFTFNLRPYVYRFTLEA
SVYALYGERLGLLKSSPNPDGLRFIQAINSMISSTSLLLYTPVNLSRLMYSKMWEKHFEA
WDYIFQFADKCIQKIYQEMCLNGSPQYSGIMAQLMAKAELSLESIKANMLELTAGSVDTT
SFPMMTTLFELARNQDLQNALRKESLEVEAHLEENPAKLIKELPLLRAAIKETLRLYPVG
LILHRYLDRDTILQNYRVPAGTLVQIFLYSMGRSPEVFPQPECYDPSRWLISNTDQENNQ
ISNFRYLVFGFGIRQCIGRRLAEAEMILFLHHVLKNFQVETLCKDDLNLSFHFVLQPKSY
PLFTFSVLN
Download sequence
Identical sequences F6S1F1
ENSMODP00000000024 13616.ENSMODP00000000024 ENSMODP00000000024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]