SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000032 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000032
Domain Number 1 Region: 631-751
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-31
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 533-635
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-29
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 300-421
Classification Level Classification E-value
Superfamily Cadherin-like 7.98e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 740-844
Classification Level Classification E-value
Superfamily Cadherin-like 2.78e-21
Family Cadherin 0.0025
Further Details:      
 
Domain Number 5 Region: 138-189,245-305
Classification Level Classification E-value
Superfamily Cadherin-like 4.36e-21
Family Cadherin 0.0074
Further Details:      
 
Domain Number 6 Region: 433-531
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-16
Family Cadherin 0.0073
Further Details:      
 
Domain Number 7 Region: 35-103
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000357
Family Cadherin 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000032   Gene: ENSMODG00000000034   Transcript: ENSMODT00000000033
Sequence length 1087
Comment pep:novel chromosome:BROADO5:5:195699202:195795621:-1 gene:ENSMODG00000000034 transcript:ENSMODT00000000033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKMRTMGLVRGWCCWCLCCFLLPVSVTLAAAKQLLRYRLAEEGPADVRIGNVASDLGIV
TGSGEVTFSLESGSEYLKIDNITGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIG
PSQSWVDLFEGRVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIE
RYELLQEPGGGGGGGGGESRRGGAVESAPYPGGGGGGSSGPGSSKRRLEVSEGGGGSASG
SGGRSTVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRV
LITDVNDNSPRFEKSVYEADLAENSTPGTPILQLRAADLDVGVNGQIEYVFGAATENVRR
LLRLDETTGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIE
IRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDT
EGDQNKKKYFLHTSAPLDYESTREYNVVIVAVDSGSPSLSSNNSLVVKVGDTNDNPPVFD
QSVVEVYFPENNIPGERVATVVATDADSGKNAEIAYSLDSAVVGIFAIDPDSGDILVNTV
LDREQNDRYEFKVTAKDKGIPILQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNS
PVGMVTVMDADKGRNAEMSLYIEEDSSIFSIENDTGTIYSTTAFDRELQTSYTFKVKAVD
GGDPPRSATATVSLFVMDENDNAPTVTYPSNISYTLLPPSSNVRTVVATVLATDSDTGVN
ADLNYSIVGGNPFKLFEIDATSGVVSLVGKLAQKHYGLHRLVVQVNDSGQPSQSTTTLVH
VFVNESVSNATVIDSQITRSLHTPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIIL
IVVMARYCRSKNKNGYEAGKKDHEDFFTPQQHDKSKKPKKDKKNKKSKQPLYSSIVTVEA
SKPNGQRYDSVNEKLSDSPSMGRYRSVNGGPGSPDLARHYKSSSPLPTVQLHPQSPTAGK
KHQAVQDLPPANTFVGAGDNISIGSDHCSEYSCQTNNKYSKQVDSVQTTQPSGHIEESCN
MNVCARK
Download sequence
Identical sequences F6S0G8
ENSMODP00000000032 ENSMODP00000000032 XP_007496660.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]