SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000038 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000038
Domain Number 1 Region: 453-576
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 234-357
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 131-238
Classification Level Classification E-value
Superfamily Cadherin-like 9.54e-24
Family Cadherin 0.0049
Further Details:      
 
Domain Number 4 Region: 347-457
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-20
Family Cadherin 0.005
Further Details:      
 
Domain Number 5 Region: 570-676
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000137
Family Cadherin 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000038
Domain Number - Region: 30-129
Classification Level Classification E-value
Superfamily Cadherin-like 0.00224
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000038   Gene: ENSMODG00000000040   Transcript: ENSMODT00000000039
Sequence length 1134
Comment pep:novel chromosome:BROADO5:5:142683376:142697325:1 gene:ENSMODG00000000040 transcript:ENSMODT00000000039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQMSWTMHFIAFFALLLFSFHGDVLGKNLKYRIYEEQRVGSVIARLSEDVADVLFKLPN
PSMVRFRAMQRGNSPLLTVREDNGEISIGAKIDREQLCQKNLNCSIEFDVITLPTEHLQL
FHIEVEVLDINDNSPQFSRPLIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSAND
FFNIEVRTRTDGAKYAELIVVRELDRELKSSYELQLTASDMGVPQRSGSSILKISISDSN
DNSPVFEKQSYVIQLLENSPVGTLLLDLNATDPDEGANGKIVYSFSSHVSPKIIETFKID
SERGHLTLFKQVDYETTKSYEIDAQAQDMGPNSIPAHCKIIIKVVDVNDNKPEININLMS
PGKEEISYVFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTN
ATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDVNDNPPHFQRSRYEFVISENNSP
GAYITSVTATDPDLGENGQVTYTILESFILGSSITTYVTIDPSNGAIYALRIFDHEEVSQ
IAFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVIVGPALRNNTAEIPIPKGAESGFHV
TRIRSVDRDSGMNAELSCSIVAGNEDNIFVIDPKSCDIYTNVSMESTPYTEWELAVLVQD
KGSPQLHTKAFLKCSVFEFVESVTSTAMTSVSQASMDVSMIIIISLGAICAVLLVIMVLF
ATRCNREKKDNRSYNCRVAESTYQHHPKRPSRQIHKGDITLVPTINGTLPIRSHHRSSPS
SSPTLERGQMSSRQSHHSHQSLNSLVTISSNHVPENFSLELTHATPAVEVSQLLSMLHQG
QYQPRPSFRGNKYSRSYRYALQDMDKFSLKDSGRGDSEAGDSDYDLGRDSPIDRLLGEGF
SDLFLTDGRIPAAMRLCTDECRVLGHSDQCWMPPLPSPSSDYRSNMFIPGEEFPTQPQPQ
HPHQSLEEDSQPIDSSEKKKSFSTFGKDVQNEEDAGDTCTSSLLSEMSSVFQRLLPPSLD
TYTECSEVDRANSLERRKGTVPAKTMGYPQGVAAWAASTHFQNPANTTGPSLGTHSSVQP
SSKWLPAMEEIPENYEEDDFDNVLNHLNDGKHELMDASELVAEINKLLQDVRQS
Download sequence
Identical sequences F6S0B5
ENSMODP00000000038 XP_001378005.2.35504 ENSMODP00000000038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]