SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000116 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000116
Domain Number 1 Region: 225-393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.7e-35
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 2 Region: 443-465,668-831
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.17e-34
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 3 Region: 68-236
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-33
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 4 Region: 841-1046
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.93e-32
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 5 Region: 1-49
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000936
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.007
Further Details:      
 
Domain Number 6 Region: 450-509
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000921
Family Fibrinogen C-terminal domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000116   Gene: ENSMODG00000000099   Transcript: ENSMODT00000000120
Sequence length 1181
Comment pep:known chromosome:BROADO5:4:114202897:114720677:-1 gene:ENSMODG00000000099 transcript:ENSMODT00000000120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFSGNTNADSIVHHKFLHSVKARFIRFVPMEWNPNGKIGMRVEVYGCSYSKYLFIKLNIL
SLLNLINSVKLILSLSFSLSLCFKSMQGDGVLFHGEGQHGDYITLELQKGKLSLHINLGD
SKLRFSNSQPSVILGSLLDDQHWHSVLIERFNKQVNFTVDKHTQHFRAKGDGDYLDIDYE
LSFGGIPVPGKPGTFLKKNFHGCIENLYYNGVNIIDLAKRRKHQIYTGNVTFSCSEPQIV
PITFVNSSSSYLLLPGTPQIDGLSVSFQFRTWNRDGLLLSTALSEDSGILLLYLEDGLLR
LVIQKMTERSMEIPTGSNLNDGLWHSVSINARRNRITLTLDNDAASAAHETTRLQIYSGN
SYYFGGCPDNFTESQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLHIDLCSI
KDRCLPNYCEHGGTCAQSWATFYCNCSDTGYTGATCHNSIYEQSCEAYRHKGNTSGFFHI
DPDGSGPLDPLYVYCNITEDKIWTAVQHNNTELIRVRGAHPKRPYVMYFNYSSSMEQLEA
MINGAEYCEQETIYHCKKSRLLNTPNGMPFTWWIGRANEKHPYWGGSLPGVQQCACGLEE
SCLDMRHFCNCDADKEECISDYPYVHGKTHLFSKLSVLSCENSRPQWIWMFFPLRVNFPE
RHFWNAPSFNTEASYLHFPTFHAEFSADISFFFKTTALSGIFLENLGIKDFIRLEISSPS
EVTFALDVGNGPMELTVLSPTPLNDNQWHYVQAERNLKQTLLQVDDLPAKILETQEDGHF
RLQLNSQLFVGGTASRQKGFLGCIRSLHLNGQKLDLEEKALVTPGVKPGCPGHCSSYGNF
CHNGGKCVEKYNGYLCDCTNSPYEGPFCKKEVSAIFEAGTSVTYVFQEPYPVTKNTSLSS
SAIYVDSMPSSKENIAFNFLTGQTPCLLLYIDSYFQDYLAVLLSKNGNLQVRYQLSKERV
HVCTFDAENFANRRMHHVKINRDGKELTIQVDQHPIYRYNFSSEVDFRAVRSLTLGKVTD
SLGLDVEVSKVNTIGFVGCLSSVQYNHIAPLKAALRHPSIAPVSVKGILVEANCRSVMEA
DINTVTTVYSSSDPFGKTDEREPLTNAVRSDSAVIGGVIAVVIFIIFCIIGIMTRFLYQH
KHSHRTNQMKEKEYPENLENSFRNDIDLQNTVSECKREYFI
Download sequence
Identical sequences F6YC49
ENSMODP00000000116 13616.ENSMODP00000000116 ENSMODP00000000116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]