SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000132 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000132
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.34e-37
Family Galectin (animal S-lectin) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000132   Gene: ENSMODG00000000125   Transcript: ENSMODT00000000136
Sequence length 142
Comment pep:novel chromosome:BROADO5:6:77106742:77113704:-1 gene:ENSMODG00000000125 transcript:ENSMODT00000000136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQFEAFCSGGLVPGWSLMVQGQTNSKDDEFEINFLSESGDIAFHFKPRFSNATLVCNS
FQTSHWGEEEVFNVFPLELKEPFEIEIFSDSEYFHVFIQENKVAQYEHRHKPLASINKVQ
VLNDLRFPLVELSKKRLYRSAL
Download sequence
Identical sequences F6YBR8
ENSMODP00000000132 ENSMODP00000000132 XP_007498448.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]