SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000144 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000000144
Domain Number - Region: 68-143
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0188
Family Myosin rod fragments 0.0056
Further Details:      
 
Domain Number - Region: 345-434
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0693
Family Sec2 N-terminal region 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000144   Gene: ENSMODG00000000131   Transcript: ENSMODT00000000148
Sequence length 493
Comment pep:novel chromosome:BROADO5:4:262699134:262772602:-1 gene:ENSMODG00000000131 transcript:ENSMODT00000000148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPGCSFANILPEPPLSTAAMVRLSASSYVVYPPDKPFLNSDIRRSPQKPTCAYPESN
SRAIFSALKNLQEKIRRLELERIQAEESVKTLSKETSEYKKVLDEQIQERENSRNEESRH
NQELTSQLLAAESKCNLLEKQLEYMRDMIKHAKNERTTVLEKQVSIERDQQQGQIHVENQ
LEKLDVLEQEYNKLTAMQALAEKKMQELESKLRQEEQERKRMQEKAAQLQTGIETNRQLF
EEKIPSYPANARRMKKKKTKQPDKKSPRNHFHVQPHYRLCLGDMPFVAGKSTTPSHAVVA
NVQHVLHLMKQHNKVLCNNRVVNSVPLAKQGPPRNGRGRKLSASSSSSTCHEELFEVLQT
LQDEFGQMSFDHQQLAKLIQETPTKELKEDLEQELEELVERMEAKANQITKVRKHQARLE
RQMKELKGSKKCLEDQESNCRLSSGVTGSSSKKDSISVNRKPGEKSRRNLQLLKDMQTIQ
TSIQKDNNLGWEY
Download sequence
Identical sequences F6YBA8
ENSMODP00000000144 ENSMODP00000000144 XP_001367499.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]