SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000178 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000178
Domain Number 1 Region: 693-929
Classification Level Classification E-value
Superfamily HCP-like 4.45e-30
Family HCP-like 0.0014
Further Details:      
 
Domain Number 2 Region: 909-1019
Classification Level Classification E-value
Superfamily HCP-like 0.0000000902
Family HCP-like 0.0099
Further Details:      
 
Domain Number 3 Region: 304-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000332
Family Laminin G-like module 0.08
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000178
Domain Number - Region: 587-658
Classification Level Classification E-value
Superfamily HCP-like 0.00288
Family HCP-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000178   Gene: ENSMODG00000000154   Transcript: ENSMODT00000000182
Sequence length 1147
Comment pep:novel chromosome:BROADO5:5:201831454:201957877:1 gene:ENSMODG00000000154 transcript:ENSMODT00000000182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGCAGQEEQQPPPATEQDCPGPGARAMSPRPAVDNGEEEEEEEEEESPRGWKSGVPPG
LSGCPSAILLLCCLNFVPCLGRQTLLTTSLIPEAKPNVTYKDFIHVIVIEGNVRNVSEVS
VQYLCSQPCVVNFEAIVSSEFRSSIPVYKKRWTNEKHLHTRRIKMVHVKFPSIMVYRDDY
FIRHSISVSAVILHAWITHKHSGDLSARWKENFLHAITKNFTLLKSVPPFERPFKDHQVC
LEWNMDYIWNLQANKIPQCPLENDMVNILSFPYASSGENTGIVKKFKRFQNRELEATRRQ
RIDYPMFTISVWLYLLHHCKAHLCGILYFVDSNEMYGTPSLFLTEEGNLHIQMHLVKGED
LAVKTNFILPLHKWFRLDISFKGGQITVTASVGQDLKSYHNQSIIFREDFYYNDTDGYFI
LGGSRYAPGIEGFFGPMKYYRLSVLDPEQIFNPLLEKQLADQIELYYGRCAEIQEIVSVY
ADILQQGDEDPRMCNHKNYYLDLNARYGRLSTCRAFPWGRELKDRYLNLFQVLQEMDLSS
VPGSHNDSVLEVGGRIFEKAVKRLSGIDGLHQISSIIPSLMDSSCCGYHKASYFLAVFYE
TGLNVPIDHLQGMLYSLVGVQGSERLSAMNLGYKHYQGIADYPLDWELSYAYYSNIATKT
PLDQHTLQGDQAYVETIRLKDDEMLKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFW
GQQGVAKNPEAAIEWYAKGALETEDPALIYDYAIVLFKGQGVQKNRRLALELMKKAAAKG
LHQAVNGLGWYYHKFRRNYVKAAKYWLKAEEMGNPDASYNLGVLYLDGIFPGSSGRNQTL
AGEYFHKAAQGGHIEGTLWCSLYYMTGNLETFPRDPEKAVVWAKHVAEKNGYLGHVIRKA
LNAYLDMSWHEALLYSVLAAETGIEVSQTNVAHICEERPEMARRYLGVNCVWRYYNFSVF
QIDAPAFAYLKMGDLYYYGHQNQSKDLDLSVQMYAQAALDGDSQGFFNLALLIEEGATIP
YHILEYLEIDQTLHSSNISILQELYERCWSHSNEDSLSPCSLALFYFYLRIICNGILHST
LIYFLGTFLLSILIALAVQYFQSVSGSGPPASVSHLSSEIATSIANPAVGSLEQEEAVPA
NNLEQRG
Download sequence
Identical sequences F6XSY1
XP_007496669.1.35504 ENSMODP00000000178 ENSMODP00000000178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]