SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000186 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000186
Domain Number 1 Region: 54-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-72
Family Calnexin/calreticulin 0.0000000437
Further Details:      
 
Domain Number 2 Region: 262-400
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.55e-56
Family P-domain of calnexin/calreticulin 0.000000416
Further Details:      
 
Domain Number 3 Region: 403-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000839
Family Calnexin/calreticulin 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000186   Gene: ENSMODG00000000160   Transcript: ENSMODT00000000190
Sequence length 607
Comment pep:novel chromosome:BROADO5:5:139251941:139293376:1 gene:ENSMODG00000000160 transcript:ENSMODT00000000190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFQGFWLCLSLLLFTSVKAELQEEDVEMEDFEESSEEIMTNEDNIIPLEVKYKTPQPIG
EVYFTETFDNGILTGWVLSKAKKEDTDENIAKYDGRWEIEDLKENRVPGDRGLVLKSQAK
HHAISALLSKPFIFADKPLIVQYEVNFQNGMDCGGAYIKLLTENDYLNLENFFDKTPYTI
MFGPDKCGEEHKLHFIFRYKHPKTEVFEEKHAKVPNVDLKKFFTDKKTHLYTLVMSPDNT
FEVYIDQVIINQGSLLEDVEPPINPPKEIEDPNDKKPDDWDDRLEIPDNTSVKPEDWDES
QPSQIADPDAFKPVGWLDDEPEYIADPNAEKPPDWNENMDGKWEAPRIPNPACEIGCGHW
QPPMIDNPKYRGKWEPPMIDNPNYQGEWTPRKIPNPDYFEDRNPFLLTSFSALGLELWSM
TSDIYFDNFIICSDKEIADHWAEDSWMVKKLVARANEPGVFTQLLTAAEERWWLWIIYTL
TAGLPLVLITLFCWPRKKKDEDAEYKKTGIHKPQTKGALEQEVKEEKAALENVADLEEEK
ENQDDGEMEKEEEDETEEKSEGENETIEGQEEGNKSGSEDEMKEADESTGSGDGPVKSVR
KRRVRKD
Download sequence
Identical sequences F6XSA8
ENSMODP00000000186 13616.ENSMODP00000000186 ENSMODP00000000186 XP_007496362.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]