SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000233 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000233
Domain Number 1 Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000225
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 2 Region: 390-520
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 365-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000739
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 4 Region: 289-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000332
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000233
Domain Number - Region: 253-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0235
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000233   Gene: ENSMODG00000000198   Transcript: ENSMODT00000000237
Sequence length 692
Comment pep:novel chromosome:BROADO5:1:197912441:197922117:1 gene:ENSMODG00000000198 transcript:ENSMODT00000000237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASGKLSHWALLLLAAFWQQHRAVGSGVFQLQLREFANERGVLASGRPCEPHCRTFFR
ICLKQFQAVFSPGICTFGNVSTPVLGTNSFAVEEESRGGGRNPIQLPFNFTWPGTFSLII
EAWHAPGDNLPPEPLPTDALISMTAIKRRLAVGENWSLDEQSGPFTRLRYSYRVICSDNY
YGDSCSRICRSRDDHFGHYVCQANGSLSCLPGWIGEYCDQPICLSGCTKQNGYCNKPGEC
LCRPGWQGRLCDKCIPHNGCRHGTCSIPWQCTCNEGWGGLFCDQDLNYCTHHAPCQNGGT
CSNSGQRGYTCTCRPGFTGIDCEDEISECDSNPCRNGGSCKDQEDGYHCLCPPSYYGPHC
EHSILSCADSPCFNGGSCREQEHGASYACECPPSFTGSNCEKKVDRCTSNPCANGAQCLE
WGSTRACRCRPGFTGPHCEININDCARNPCAHGGTCRDRVNAYDCACPPGFSGRNCELRT
AANACVSGPCLNGGTCYAGLSSDSFVCNCPYDFTGSRCELLFSPSAPVVQPPSGFPWVAV
SLGVGLAAILVLLGMVAVAVRQLRLRQPEAGGREAMNNLSDFQKDNLIPATQLKNTNQKK
ELEVDCDVDKSNCSKQQKHMDYNLAPGPLGRGITLGKYPPSDKSLGEKAPLRLHSEKPEC
RISAICSPRDSMYQSVCLISEERNECVIATEV
Download sequence
Identical sequences F6TFF9
13616.ENSMODP00000000233 ENSMODP00000000233 XP_007480133.1.35504 ENSMODP00000000233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]