SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000251 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000251
Domain Number 1 Region: 319-381
Classification Level Classification E-value
Superfamily BPTI-like 5.39e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0031
Further Details:      
 
Domain Number 2 Region: 443-505
Classification Level Classification E-value
Superfamily BPTI-like 8.66e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0044
Further Details:      
 
Domain Number 3 Region: 396-434
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000969
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000251
Domain Number - Region: 266-321
Classification Level Classification E-value
Superfamily PKD domain 0.0018
Family PKD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000251   Gene: ENSMODG00000000212   Transcript: ENSMODT00000000255
Sequence length 596
Comment pep:novel chromosome:BROADO5:1:197775472:197796940:1 gene:ENSMODG00000000212 transcript:ENSMODT00000000255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPAPTWWRLTQFHLKLSWRWLPGSQGLVVREELGGRRSRSGGTRIGPTPSHSPAQVPD
TLRAQSNARKVTLLGRKVLLPGRKMTPRLGYPEAWITTILWLLVTFSLPDSVTGQPPVAP
GKPAGSTCLEQYTVGVPDFVLDTDASVSNGATFLGSPEVRRGWDCVRACCSTPSCNLALV
EQKPGEGEDAISACFLLNCLYEQTFVCKFSRKEGFLNYLTRDVYQSYRELRKQGFGGARL
PKSWAGMEIKVQPQEPLVLQGTENTEWHLLQGDTNVKVEKKDTDHLELSQLKEGTYIFQL
TVKDSDQKQDTANFTITVLSPKQTEEHCLAPKKVGRCRGSFPRWYYDPTEQQCKQYVYGG
CLGNKNNYIREEECKMACKDVQGPSIQRQHPVCSGTCQPSEFQCRDGCCIDGFLECDDTP
DCLDASDEATCDKYTTGFDELQSIHFPSNKGHCVDLPVTGLCQERIPRWYYNPFDEHCAL
FTYGGCGGNQNNFLDKEKCLKSCEGISKKDVFGLRRESLHGNTGSMEVTVAVLLGICILI
VIAILGYCLFKNQLNRSLRRHHPLHHHRPPPMPTSNPISITEDTEHLVYNHTTRPL
Download sequence
Identical sequences F6SZP7
ENSMODP00000000251 ENSMODP00000000251 XP_001381154.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]