SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000253 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000253
Domain Number 1 Region: 21-119
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-20
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Domain Number 2 Region: 1006-1146
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000345
Family Nucleotide and nucleoside kinases 0.004
Further Details:      
 
Domain Number 3 Region: 677-758
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000146
Family PDZ domain 0.025
Further Details:      
 
Domain Number 4 Region: 179-441
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000621
Family Tropomyosin 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000253
Domain Number - Region: 845-886
Classification Level Classification E-value
Superfamily QueA-like 0.0497
Family QueA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000253   Gene: ENSMODG00000000213   Transcript: ENSMODT00000000257
Sequence length 1151
Comment pep:novel chromosome:BROADO5:6:78258748:78401760:-1 gene:ENSMODG00000000213 transcript:ENSMODT00000000257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARGGGPEMGDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDED
EVLSAPMLPSKINRSGRLLDILHTKGERGYVVFLESLEFYYPELYKLVTGKEPTRRFSTI
VVEEGHEGLTHFLMNEVIKLQQQMKAKDVQRCELLAKSRQLEDEKKQLTLTQMELMTFQE
RYQKMKEERDNYNDELIKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNK
MEEECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKIQELQSIIQAGKRSLPDSD
KAILDILEHDRKEALEDRQELVNKIYNLQEEMRQAEELRDKYLEEKEDLELKCSTLGKDC
DMYKHRMNTVMIQLEEVEKERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDELR
IEMVRKEACIVNLESKVRRLSKDSNGLDQSLPRNLPVTVISQTFGDSSPKANGQEADDSS
TSEDSPEDSKYFLPYHPPKRRMNLKGIQMQRAKSPVSMKRASDFQENGMDASSSSSNPLS
IDSSFNKMLPHRNRNSIMSITAEPPGNDSIVRRCKEDAPHRSIVEEDTDSFGFDALDLDD
DNHDRYSFGPPSIHSSSSSHQSESLDAFDLEQVNFMFRKFSLERPFRPSVTSVGHIKTTC
HPVQHTTLNGDNLITEITLLGGNDRGSFIHSVKPGSLAEKEGLREGHQLLLLEGCIKGEK
QSVPLDTCTKEEAHWTIQRCNGPVTLHYKFNHEGYRKLLKDMDDGLITSGDSFYIRLNLN
ISSQLDSCSMSVKCDEVVHVRDTMYQDKYEWLCARVDPFNNRDLEMGTIPSYSRAQQLLL
VKLQRLMHRGNREETENSHHTLRALRNTLQPEEPLAMNDPRVSPRLSRASILFGQLIQFV
SRSENKYKRMNSNERVRIITSGHPGNLARASLDVMKPLSEKHEDVDSENDLNKSLNLIPY
SLVRSFYSERRRPVLFTPTMLAKTLVQKLLNSGGAMEFNMCKPDVVTKEEFLRKEKTETI
IFSREKNPNTFECIVPGNIEAVAAKNKHCLLEAGISCTKDLIKAKIYPIVLFIRVSEKNI
KKFRKLLPRPETEEEFLRVCRQKEKELEALPCLYASVEVDMWSSVEDLIRVIKEKIGEEQ
HKTIWIDEDQL
Download sequence
Identical sequences F6SZN4
ENSMODP00000000253 ENSMODP00000000253 XP_007498473.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]