SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000310 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000310
Domain Number 1 Region: 430-560,599-654,688-756
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-27
Family Kelch motif 0.0084
Further Details:      
 
Domain Number 2 Region: 236-361
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-17
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1713-1818
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000000641
Family Kelch motif 0.035
Further Details:      
 
Domain Number 4 Region: 1420-1468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000572
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 1372-1420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000339
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 6 Region: 1283-1318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000310
Domain Number - Region: 391-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00191
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1504-1607
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00563
Family Spermadhesin, CUB domain 0.0086
Further Details:      
 
Domain Number - Region: 1112-1135
Classification Level Classification E-value
Superfamily Plexin repeat 0.0141
Family Plexin repeat 0.0046
Further Details:      
 
Domain Number - Region: 1062-1093
Classification Level Classification E-value
Superfamily Plexin repeat 0.0214
Family Plexin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000310   Gene: ENSMODG00000000255   Transcript: ENSMODT00000000314
Sequence length 1892
Comment pep:novel chromosome:BROADO5:Un:66732077:66746784:-1 gene:ENSMODG00000000255 transcript:ENSMODT00000000314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSEKVLPLTSVPLWGSSWGSRRLSRHPIQVVPFESSWPSPWSASEPPSFLFHMGSGSQP
LEVALPRSAKHSTHCISGPPTSPGRDILNFTVGEMEAGKGWPGLESLVRKLLRLDLNLSL
SSLWHPPAASKSFVPRGLFLGAEMPFNGRLRVLCSLVPWPLVLCASLLEEERPRDGAVDE
APLLPSHSASLPTQLPQGPAMASAPAWGPWALVAVTLLWPQAPWAQAGDCKGQRQVLREA
PGYVSDGAGNYSVNGNCEWLIEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPRGPLLA
SLSGSTRPPPIEASSGKVPSYCPPSLLGLPFLSPSPMLLHLFSDANYNLLGFNASFSFSL
CPGGCSGRGLCEPSGLCTCDPGWGGPACAHQDCFTYCREHGTCASEAGPCRCEPGFLGRA
CDLRLWENQGAGWWHNVSSEDAAFPARVGAAGAFLSPPGLLAVFGGQDLNSALGDLVLYN
FSANAWERWDVSPGPAARHSHVAVAWAGSLVLMGGELADGSLTSDVWAFSPRAGGRWELL
APPSSGPPGLAGHAAALVDDSWLYCLRPARPRHLWPRARSRLPAICPLTVTPSASLSFSR
FSVRVNSTELFHVDLRVWTSLRGRDGQRGPRERAFHTASVLGNYMVVYGESAGRPCFLRG
PPPLQVCLILPPWASGGNVHTHYQEEKCYEDGIFFYHLGCHQWVSGAELAPPGTPEGRAA
PPGGRYSHVAAVLGGSVLLVAGGYSGRPRGDLMAYKVPPFVFQAPAPDYHLDYCSMYTEH
SVCARDPECSWCQGACQAAPPPGSPPGACPAAGCLGLARLLGDCQACLAFSSVVPPPRGP
GALGWCVHNESCLPRPEQARCRGEQISGTVGWWGAAPVFVITLDACVTQSFLPGLHLLTF
QQPPNASQPDKVSIVRSTTITLSQTSNTETDVSLVYRGFIHPLLPGGPAGSGAEDVIVWA
RAQRLRVLARMARGPDSQHMEEVGRWVAQQDKEIRRLQRPGSARLFPFPGRGHKYAVEIQ
GQLNSSAGSGNSELTLLWDRTGVPGGSEISFFFLEPFRSSACTSYTSCLGCLADQGCGWC
PLTSSCLLRRDGTQCSGGGALLVLAPALCPLCEEHRDCHACAQDPFCEWQQSLSRKGDAT
CSRRGRAGSAVRSPTNCPPLCNQRHSCETCLANSSQCAWCQSTQTCFLFAAYLARYPHGG
CRGWDDSVHSEPRCMSCARFLSCHDCLQSHECGWCGNEDNPTLGRCLPGDFSGPMGGGPC
SLGAGEGLPPGLPAHWSYAQCPDVDECRLGLARCHPLASCLNTPVSYECHCGHGYHGDGV
THCNQTCLEDCGHGTCSGPPDFTCMCDLGWTSDPPLPTPAPGPPAPLCSRDCGCNFHSYC
HTRGPGICDECQDWTWGEQCERCRPGSFGNATGPGGCQPCQCNGHGDPQQGHCDGHTGLC
FCQDHTEGAHCELCAPGYYGDPRAGGSCFRECGGRALLTNVSSVALGSRRAGGPPQVGSQ
AGPGLAYCVWVVSASENLEPCPPGVPCPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTG
IVQSDRSLIAAFCGQRRDRPLTVQALSGLLVLHWEANGSSSWGFNASVGSGRCEMGPGGP
GSCPAPQECVPEEAGGGSAGRCRCPPGWAGPACTLALCPGNCSAHVGGGICNQSLGLCVC
FEGFGGADCATRLDGGQLVWETLLDSRLSADTASRFLHRLGHTMVEGPDSTLWMFGGLGL
PQGLLGNLYRYSVGERRWTQMLAGSEDGGPGPAPRSFHAAAYVAAGRGAMYLLGGLTAGG
VARDFWVLNLTTLQWRQEKASMATRPSTMRPRTHSTSLEASASTWSWPLRPLSFTPCTAL
TGPGVCWPLPRGQSPGPGSSMRRPCLGTPWWS
Download sequence
Identical sequences H9H5V3
ENSMODP00000000310 ENSMODP00000000310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]