SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000353 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000353
Domain Number 1 Region: 13-105
Classification Level Classification E-value
Superfamily DEATH domain 7.53e-22
Family Caspase recruitment domain, CARD 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000353   Gene: ENSMODG00000000299   Transcript: ENSMODT00000000360
Sequence length 232
Comment pep:novel chromosome:BROADO5:2:42785217:42799717:1 gene:ENSMODG00000000299 transcript:ENSMODT00000000360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSAPALTEEDMAEVKKDALENLRVYLCEKIIAERHFDHLRARKILTREDTEEISCRTS
SKKRAGKLLDYLQENPKGLDTLVESIRREKTQSFLIEKITDEVQKLKILKLEYLKGLHHN
SYMPLPPGTTNSLSRLDSNECNFSDKLKDGEATVVYHPTGESSTASFYSNNSLLNLPVVE
VGRTENSVFSSTPLPGPGDPGAPPLPLEPQSEEEGNCNDLFLPLRSRSFCQQ
Download sequence
Identical sequences F6WAI0
ENSMODP00000000353 ENSMODP00000000353 13616.ENSMODP00000000353 XP_001366114.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]