SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000368 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000368
Domain Number 1 Region: 59-200
Classification Level Classification E-value
Superfamily Cytochrome P450 1.57e-53
Family Cytochrome P450 0.0000187
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000368
Domain Number - Region: 214-248
Classification Level Classification E-value
Superfamily Cytochrome P450 0.014
Family Cytochrome P450 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000368   Gene: ENSMODG00000000307   Transcript: ENSMODT00000000375
Sequence length 249
Comment pep:novel chromosome:BROADO5:Un:62925387:62934935:-1 gene:ENSMODG00000000307 transcript:ENSMODT00000000375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLTHYRRALRTVVDYGAGSEFPRSELTHPPARISSITGLRGISLVVVVSSRDLEGNISS
NLKENNLVSCTLDLFFAGTESTSTTLKWALLYMAFYPEIQGKIQAEIDRVVGQSRQPTMA
DRENMPYTNAAVHEVQRMGNIIPLMEPKVATVDTTLAGYHVPKGTRVVTNMTSLHRDPKE
WATPETFNPEHFLENGEFKKRVLSAFLSSYVQRRRRRQQSKYPPGPLRLPIFGNVFEIDI
KKPHISIQE
Download sequence
Identical sequences H9H5W2
ENSMODP00000000368 ENSMODP00000000368 13616.ENSMODP00000000368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]