SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000418 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000418
Domain Number 1 Region: 518-765
Classification Level Classification E-value
Superfamily vWA-like 1.33e-72
Family Trunk domain of Sec23/24 0.00009
Further Details:      
 
Domain Number 2 Region: 244-426,766-861
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.83e-58
Family beta-sandwich domain of Sec23/24 0.0016
Further Details:      
 
Domain Number 3 Region: 968-1109
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.88e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.00058
Further Details:      
 
Domain Number 4 Region: 863-967
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 8.11e-31
Family Helical domain of Sec23/24 0.0065
Further Details:      
 
Domain Number 5 Region: 428-514
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 4.19e-25
Family Zn-finger domain of Sec23/24 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000418   Gene: ENSMODG00000000346   Transcript: ENSMODT00000000427
Sequence length 1113
Comment pep:novel chromosome:BROADO5:1:50482582:50500584:1 gene:ENSMODG00000000346 transcript:ENSMODT00000000427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVNQPAPPGVPYGQPQPGYTGYQSGYGGQPGPIIPPTPYGAYNGPMPGYQQLPPPGVPR
APPSSGTPPASTTARVPSGQPAYGQFGQGDVQNGPSSTVQMQRPPVSQPFVPAPVAPLVN
QPAPFQPYGPPPTSTQVTTQMAGMQISGPAAPPPSALGYGPPTSMASASGSFPGSNLYGS
YPQNLAPPTSLAQVHPGAQTPQRSAPLQASSFPPSAAGGPRPPSIAGPSMPGQSFGGPPV
SQSNHASSPPPQAQPPMTGPPGPPPPMHSSQPGYQVQQNGSFGPARGPQPNYGGVYSGAP
NFGSQPGPPQPPPPKRLDPDSIPSPQLNELPPQQKTRHRIDPDAIPSPIQVIEDDRNNRG
SEPFVTGARGQVPPLVTTNFIVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKP
LARLPPEEAPPYVVDHGESGPVRCNRCKAYMCPFMQFIEGGRRFQCCFCSCVTEVPPQYF
QHLDHTGKRVDFYDRPELSLGSYEFLATVDYCKNNKFPRPPAFIFMIDVSYNAVRSGLVQ
LLCEELKSLLDFLPREGGAEESAVRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMFV
PLLDGFLVNVNESRPVITSLLDQIPEMFADTRETETVFAPVIQAGMEALKAAECPGKLFL
FHTSLPIADAPGKLKNRDDRKLLNTDKEKTLFQPQTGFYQSLAKECVAQGCCVDLFLFPN
QYVDVATLGIVPHHTGGSIYKYACFQVESDQERFLSDLRRDVQKDVGFDAVMRVRTSTGI
RATDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLSEDGGALIQCALLYTSCAGQRR
LRIHNLSLNCCTQLADLYRNCETDTLINYLAKFAYRGVLNSPVKTVRDSLVSQCAQILAC
YRKNCASPSSAGQLILPECMKLLPVYLNCVLKSDVLQPGAEVTTDDRAYVRQLVTSMDVA
ETNVFFYPRLLPLTKVPAESSAEPPAVRASEERLSKGDVYLLENGLNLFLWVGASVQQGV
VQSLFSVPSFSQITSGLSALPVLENPLSKRVRDLIDSFRAQRSRYMKLIVVKQEDKLEML
FKHFLVEDKSLSGGASYVDFLCHMHKEIRQLLS
Download sequence
Identical sequences F6RUF2
ENSMODP00000000418 ENSMODP00000000418 XP_007478458.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]