SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000559 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000000559
Domain Number - Region: 8-201
Classification Level Classification E-value
Superfamily Tropomyosin 0.00154
Family Tropomyosin 0.0072
Further Details:      
 
Domain Number - Region: 222-268
Classification Level Classification E-value
Superfamily Prefoldin 0.0575
Family Prefoldin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000559   Gene: ENSMODG00000000471   Transcript: ENSMODT00000000574
Sequence length 548
Comment pep:novel chromosome:BROADO5:5:203546844:203695388:1 gene:ENSMODG00000000471 transcript:ENSMODT00000000574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEAMNFNRTESDWQGLVSEYLVCKRKLESKKEALLILSKELDTCQQERDQYKLMANQLR
ERHQSLKKKYRELIDGDPSIPPEKRKQANLAQLLSDSRDRNKHLGEEIKELQQRLGEIQG
DNKLLRMTIAKQRLGDEEIGARHFAAHEREDLVQQLERAREQIESLEHDLQASVDELQDI
KEERSSYQDKVDRLNQELNHILGGHENRIIDVDALCMENRYLQERLKQLHEEVSLLKSNI
AKYKNALERRKNSKSQGRSSNSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISDLKS
LATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGLSYNVSVGFR
RGKDTITFNDSTLPVMKRSRSPLLKFLDQQEQNKIYTKDGEQKEGDESSSVAVALTAPEE
AAAQLSDNSPAKPKQGNQRKHFHPSLPQLPSEEEEINRLGSEIIKLTEEQAAEELEGTRK
GSSQEDPRKGTGPSHIKGMAKVESPLSSPDPFGSSESLGLGKEQALEGCDPEEEKAIPEE
SCSGIVKT
Download sequence
Identical sequences F6URH4
ENSMODP00000000559 ENSMODP00000000559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]