SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000602 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000602
Domain Number 1 Region: 15-52
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000000157
Family Ran binding protein zinc finger-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000602   Gene: ENSMODG00000000504   Transcript: ENSMODT00000000617
Sequence length 287
Comment pep:novel chromosome:BROADO5:2:20426185:20452895:1 gene:ENSMODG00000000504 transcript:ENSMODT00000000617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYG
GGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVGPASILKEVEDKESEGEEEDEDED
LSKYKLDEDEDEDDADLSKYNLDASEEEDGNKKKSHRRSRSKSRSSHSRSSSRSSSHSSS
RSRSRSRSGSSSSSRSRSRSSSRELSRSRGSKSRSSSRSHRGSSSPRKRSYSSSSSSPER
GSKRSRSRSSSPGDRKKRRTRSRSPERRRRSSSGSSHSGSRSSSKKK
Download sequence
Identical sequences F6Y669
ENSMODP00000000602 ENSMODP00000000602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]