SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000630 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000630
Domain Number 1 Region: 1-425
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.96e-124
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000630
Domain Number - Region: 433-478
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0377
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000630   Gene: ENSMODG00000023365   Transcript: ENSMODT00000000645
Sequence length 764
Comment pep:known chromosome:BROADO5:3:527161035:527198345:1 gene:ENSMODG00000023365 transcript:ENSMODT00000000645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVMFAIEEINKDSSLLPNISLGFHLYNSYHSDERTLESSLQWLSGQGQFTPNYSCREKEK
SMAVIGGTTSALSVQMGTLLDLYKFPQISFGPFDSILNDKIQFPFLYQMAPKDSSLQQGV
VCLMVYFKWNWVGLIASDDMRGEKFLSEIRRQMAKNDVCVSFTEKIPVSERRYMESHDKF
MPRIITSSAKVIVIHGDTDSLMILRYSQVPLLPIEKVWIATSHWDISMRPLYSEGNSFHG
ALTFSYLTSEIPGFKTFLKVVTPSKYPDDILLRGFWLSAFRCPDAPENPEQEICSPNASL
DILPLCSFDMAMSGLSYTIYNTVYAVAWALHEMLMRKSEKKSMVDEDDLALHSWQLHSFL
KNIQFNNSAGDQVFVDENRSSEAQYAIMNYVFFPNETDALVKVGQFVSKAPLGQDFTICE
DAIVWGWWDSTVPRGVCSNSCDPGFRKTPLEGQPVCCFDCFPCPEGEISSHMEHCMKCPE
DTYPNKQRDHCVPKPVTFLNVKEPLGMTLMCMAVSFSLLTALVLGVFVKFQDTPIVKANN
RTLSYTLLISLIFCFLCSLLFIGRPTTATCLLQQTVFGVVFTVAISSIMAKTIIVVLAFR
VIRPGSRIRMFVHPTASIYVVLICSGIQVTFCGIWLGTSPPFPEADTHSEYGHIILRCNE
GSVFAFYSVLGYMALLALGSFTVAFLARNLPDAFNETKFITFSMLVFCSVWITFLPTYQS
SKGKAMVTVEIFSILASSAGLLCCIFIPKCYVILLKPDRNTQEQ
Download sequence
Identical sequences F6Y526
ENSMODP00000000630 ENSMODP00000000630 13616.ENSMODP00000000630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]