SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000647 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000647
Domain Number 1 Region: 6-131
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.79e-44
Family Galectin (animal S-lectin) 0.00000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000647   Gene: ENSMODG00000000538   Transcript: ENSMODT00000000662
Sequence length 132
Comment pep:novel chromosome:BROADO5:8:92516758:92526705:-1 gene:ENSMODG00000000538 transcript:ENSMODT00000000662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDKVEIHHMDLKQGMTLKLKGKINDDANGFVINLGQSPGNLDLHFNPRFGEKTIVCNS
QNGGRWEQEHRDDHVCFSPGTEIKLTVTLEEDEFQVKLPDGHQVKFPNRRKCSHLPYCCV
EGGISLTSFKLD
Download sequence
Identical sequences F6XMY8
XP_007503517.1.35504 ENSMODP00000000647 ENSMODP00000000647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]