SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000651 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000651
Domain Number 1 Region: 185-454
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.78e-73
Family Crotonase-like 0.000000065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000651   Gene: ENSMODG00000000542   Transcript: ENSMODT00000000666
Sequence length 455
Comment pep:novel chromosome:BROADO5:2:2368653:2390128:1 gene:ENSMODG00000000542 transcript:ENSMODT00000000666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRISLYSGGIYRDRNLELSLQEGGSLRGKTGPFSTFAAPVALTGALGKVQIGDKQRPDS
KPATGLCTPRGAQALRDLRSKQPLEKVPSPPGPLASFSAPKGVGPAVPPSARLPPSPLAG
LSGCSLCIAAPRRRPGATAPAHVVAAAMLRTLPRALRPLTPGWTLARGWASGDAAQSAEI
QVRALRGDRDAGITEILMNRPHTRNALGKVFVSQLSDALDELRLDRSVRVVVFKSCVQGV
FCAGPTPAMRAPDLPGADLKEREQMSEPEVAAFVHKLRALMNQIATFPAPTIAALDGFAL
GGGLELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCVGVGLAKELIFTGRRIS
GEEAKAIGLVNHAVPQDQEGTAAYRRSLELAREIVPQAPIAVRMGKVAIDRGMEVDISSG
MAIEGMCYAQNIPTRDRLEGMAAFREKRPPRFVGE
Download sequence
Identical sequences F6XMQ1
ENSMODP00000000651 ENSMODP00000000651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]