SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000673 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000673
Domain Number 1 Region: 13-478
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.24e-168
Family Family 1 of glycosyl hydrolase 0.0000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000673   Gene: ENSMODG00000000560   Transcript: ENSMODT00000000688
Sequence length 483
Comment pep:novel chromosome:BROADO5:5:205875633:206009288:-1 gene:ENSMODG00000000560 transcript:ENSMODT00000000688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSSTLNHEELTFPEGFCWGAATAAYQIEGGWDADGKGPNVWDTFTHQGGDRVFRNQTA
DVACGSYARWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKMIDDLLA
NGVIPMVTLYHFDLPQHLEDQGGWKTGAIVEVFDAYAQFCFGTFGDRVKLWITINEPNVL
AFFAYEKGKFPPGIPNPGTGAYQTAHNMIKAHAKAWHSYDSLFRKKQNGQVSLAIFSPWV
APADPASVTDQEAAKRAMALALDLFAKPIFIDGDYPAVLKSQVAAMSKKQGFLSSRLPEF
TEEEKRMIKGSADFFAVQYYTTRLAKHHENSEGELNCLKDINVEIFPDPSWQVSQQGSWI
HVVPWGIRELLKYIKDTYNNPVIYITENGFPQGDPAPLDDTQRWEYFRQMIQELYKAIHL
DEVNLQGYYVWSLLDNFEWTDGYSFRFGLYYVDFDNPALPRFPYKSAMEYAKVIQNNGIK
GPL
Download sequence
Identical sequences F6X525
ENSMODP00000000673 ENSMODP00000000673 XP_007496720.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]